SPRINT Home UMBER Home Contents Standard Search Advanced Search Relation Search

==SPRINT==> PRINTS View



  selected as


PR01441

Identifier
CELLSNTHASEC  [View Relations]  [View Alignment]  
Accession
PR01441
No. of Motifs
15
Creation Date
04-NOV-2000
Title
Cellulose synthase subunit C signature
Database References
Literature References
1. WONG, H.C., FEAR, A.L., CALHOON, R.D., EICHINGER, G.H., MAYER, R.,
AMIKAM, D., BENZIMAN, M., GELFAND, D.H., MEADE, J.H. AND EMERICK, A.W. 
Genetic organization of the cellulose synthase operon in Acetobacter xylinum.
PROC.NATL.ACAD.SCI.U.S.A. 87 8130-8134 (1990). 
 
2. SAXENA, I.M., LIN, F.C. AND BROWN, R.M.JR.
Cloning and sequencing of the cellulose synthase catalytic subunit gene of
Acetobacter xylinum.
PLANT MOL.BIOL. 15 673-683 (1990).

Documentation
An operon encoding 4 proteins required for bacterial cellulose biosynthesis
(bcs) in Acetobacter xylinum has been isolated via genetic complementation
with strains lacking cellulose synthase activity [1]. Nucleotide sequence
analysis showed the cellulose synthase operon to consist of 4 genes, 
designated bcsA, bcsB, bcsC and bcsD [1], all of which are required for 
maximal bacterial cellulose synthesis in A.xylinum [1]. 
 
The calculated molecular mass of the protein encoded by bcsC is 141.0kDa [1].
The function of BcsC is unknown. The sequence shares a high degree of
similarity with E.coli YhjL.
 
CELLSNTHASEC is a 15-element fingerprint that provides a signature for 
cellulose synthase subunit C. The fingerprint was derived from an initial 
alignment of 2 sequences: the motifs were drawn from conserved, largely
hydrophobic, regions spanning virtually the full alignment length. Two
iterations on SPTR39_14f were required to reach convergence, at which point
a true set comprising 4 sequences was identified. Two partial matches were
also found: Q9WX71 is Acetobacter xylinum BCSCII protein, which matches
motifs 3, 5, 7, 14 and 15; and YHJL_ECOLI is an E.coli hypothetical 128.7kDa 
protein that matches motifs 6 and 14.
Summary Information
   4 codes involving 15 elements
0 codes involving 14 elements
0 codes involving 13 elements
0 codes involving 12 elements
0 codes involving 11 elements
0 codes involving 10 elements
0 codes involving 9 elements
0 codes involving 8 elements
0 codes involving 7 elements
0 codes involving 6 elements
1 codes involving 5 elements
0 codes involving 4 elements
0 codes involving 3 elements
1 codes involving 2 elements
Composite Feature Index
15444444444444444
14000000000000000
13000000000000000
12000000000000000
11000000000000000
10000000000000000
9000000000000000
8000000000000000
7000000000000000
6000000000000000
5001010100000011
4000000000000000
3000000000000000
2000001000000010
123456789101112131415
True Positives
ACSC_ACEXY    BCSC_ACEXY    O82861        Q9WX63        
True Positive Partials
Codes involving 5 elements
Q9WX71
Codes involving 2 elements
YHJL_ECOLI
Sequence Titles
ACSC_ACEXY  CELLULOSE SYNTHASE OPERON C PROTEIN - Acetobacter xylinum (Acetobacter pasteurianus). 
BCSC_ACEXY CELLULOSE SYNTHASE OPERON C PROTEIN - Acetobacter xylinum (Acetobacter pasteurianus).
O82861 CELLULOSE SYNTHASE SUBUNIT C - Acetobacter xylinum (Acetobacter pasteurianus).
Q9WX63 BCSCI PROTEIN - Acetobacter xylinum (Acetobacter pasteurianus).

Q9WX71 BCSCII PROTEIN - Acetobacter xylinum (Acetobacter pasteurianus).

YHJL_ECOLI HYPOTHETICAL 128.7 KDA PROTEIN IN DCTA-DPPF INTERGENIC REGION - Escherichia coli.
Scan History
SPTR39_14f 2  50   NSINGLE    
Initial Motifs
Motif 1  width=21
Element Seqn Id St Int Rpt
RFWLQQQQYDNARQALQNAER ACSC_ACEXY 57 57 -
RFWMQQHQYENARQSLQSAAR BCSC_ACEXY 72 72 -

Motif 2 width=13
Element Seqn Id St Int Rpt
SLAVEYYQTMAGV ACSC_ACEXY 167 89 -
SLAVEYYQTLAGV BCSC_ACEXY 182 89 -

Motif 3 width=18
Element Seqn Id St Int Rpt
NPQDYRAQLAFAQALTYN ACSC_ACEXY 197 17 -
NPSDFRAQLALAQVLTYQ BCSC_ACEXY 212 17 -

Motif 4 width=23
Element Seqn Id St Int Rpt
PVEAAAAAQSYRQTLSWLPVNPE ACSC_ACEXY 236 21 -
PVEAATAEKSYRQTLSWLPVTPE BCSC_ACEXY 251 21 -

Motif 5 width=27
Element Seqn Id St Int Rpt
RRYFEEAMAADPKTADRWRPALAGMAV ACSC_ACEXY 345 86 -
HRYLEDAIAADPKNAAHWRPALAGMAV BCSC_ACEXY 360 86 -

Motif 6 width=21
Element Seqn Id St Int Rpt
YRGILSREPNNQLALMGLARV ACSC_ACEXY 428 56 -
YRAILARNGDNPIALMGLARV BCSC_ACEXY 443 56 -

Motif 7 width=21
Element Seqn Id St Int Rpt
DPWVRINLANALQQQGDVAEA ACSC_ACEXY 508 59 -
DPWLRINLANALQQQGDSAEA BCSC_ACEXY 523 59 -

Motif 8 width=22
Element Seqn Id St Int Rpt
DYSPAIRSIAEEMEIKQDLASR ACSC_ACEXY 572 43 -
DYSPAIRTIADEMAIKADLASR BCSC_ACEXY 587 43 -

Motif 9 width=25
Element Seqn Id St Int Rpt
RGVAVADLFRQRGDMVHARMALRIA ACSC_ACEXY 617 23 -
RGVAVADLFRQRGDMLHAHMALRIA BCSC_ACEXY 632 23 -

Motif 10 width=19
Element Seqn Id St Int Rpt
YMKISNPVAAARLLAPLGD ACSC_ACEXY 660 18 -
YMKISNPVAAARLLAPLGD BCSC_ACEXY 675 18 -

Motif 11 width=29
Element Seqn Id St Int Rpt
KALEIDLAVLRHNPQDLDARQAAVQAAVN ACSC_ACEXY 753 74 -
HALDIDLAVLRHNPQDLDARQAAVQAAAN BCSC_ACEXY 768 74 -

Motif 12 width=30
Element Seqn Id St Int Rpt
WLAMAVADQADGHGQRTIEDLRRAYDLRLQ ACSC_ACEXY 806 24 -
WLGMAVADRAVGHGDRTLADLRRAYELRLQ BCSC_ACEXY 821 24 -

Motif 13 width=24
Element Seqn Id St Int Rpt
GQVEATLGNTILYGGGGYAIQTGK ACSC_ACEXY 1111 275 -
GQVEATLGNTIVYGGGGYAIQTGH BCSC_ACEXY 1103 252 -

Motif 14 width=25
Element Seqn Id St Int Rpt
YFGYAKNEDFYTYGQGGYFSPQSYY ACSC_ACEXY 1168 33 -
YFGYKHNEDFYTYGQGGYFSPQSYF BCSC_ACEXY 1160 33 -

Motif 15 width=22
Element Seqn Id St Int Rpt
DWDVTGSVGYQVFHEHSAPFFP ACSC_ACEXY 1208 15 -
DWDVTGSIGYQLFHEHSSAFFP BCSC_ACEXY 1200 15 -
Final Motifs
Motif 1  width=21
Element Seqn Id St Int Rpt
RFWLQQQQYDNARQALQNAER ACSC_ACEXY 57 57 -
RFWMQQHQYENARQSLQSAAR BCSC_ACEXY 72 72 -
RFWLQQQQYDNARQALQNAQR O82861 57 57 -
RFWLQQQQYDNARQALQNAQR Q9WX63 58 58 -

Motif 2 width=13
Element Seqn Id St Int Rpt
SLAVEYYQTMAGV ACSC_ACEXY 167 89 -
SLAVEYYQTLAGV BCSC_ACEXY 182 89 -
SLAVEYYQTMAGV O82861 167 89 -
SLAIEYYQTMAGV Q9WX63 168 89 -

Motif 3 width=18
Element Seqn Id St Int Rpt
NPQDYRAQLAFAQALTYN ACSC_ACEXY 197 17 -
NPSDFRAQLALAQVLTYQ BCSC_ACEXY 212 17 -
NPQNYRAQLAFAQALTYN O82861 197 17 -
NPQDYRAQLAFAQTLTYN Q9WX63 198 17 -

Motif 4 width=23
Element Seqn Id St Int Rpt
PVEAAAAAQSYRQTLSWLPVNPE ACSC_ACEXY 236 21 -
PVEAATAEKSYRQTLSWLPVTPE BCSC_ACEXY 251 21 -
PVEAAAATQSYRQTLSWLPVNPD O82861 236 21 -
PVEAAAAAQSYRQTLSWLPVTAE Q9WX63 237 21 -

Motif 5 width=27
Element Seqn Id St Int Rpt
RRYFEEAMAADPKTADRWRPALAGMAV ACSC_ACEXY 345 86 -
HRYLEDAIAADPKNAAHWRPALAGMAV BCSC_ACEXY 360 86 -
HRYFEEAMAADPKTADRWRPALAGMAV O82861 345 86 -
RRYFQEAMAADPKTADRWRPALAGMEI Q9WX63 346 86 -

Motif 6 width=21
Element Seqn Id St Int Rpt
YRGILSREPNNQLALMGLARV ACSC_ACEXY 428 56 -
YRAILARNGDNPIALMGLARV BCSC_ACEXY 443 56 -
YRGILSREPNNQLALMGLARV O82861 428 56 -
YRSVLARDPNNQLALMGLARV Q9WX63 429 56 -

Motif 7 width=21
Element Seqn Id St Int Rpt
DPWVRINLANALQQQGDVAEA ACSC_ACEXY 508 59 -
DPWLRINLANALQQQGDSAEA BCSC_ACEXY 523 59 -
DPWVRINLANALQQQGDVAEA O82861 508 59 -
DPWVRINLANALQQQGDVAEA Q9WX63 509 59 -

Motif 8 width=22
Element Seqn Id St Int Rpt
DYSPAIRSIAEEMEIKQDLASR ACSC_ACEXY 572 43 -
DYSPAIRTIADEMAIKADLASR BCSC_ACEXY 587 43 -
DYSPAIRSIAEEMEIKQDLASR O82861 572 43 -
DYSPAIRSIAEEMQIKEDLASR Q9WX63 573 43 -

Motif 9 width=25
Element Seqn Id St Int Rpt
RGVAVADLFRQRGDMVHARMALRIA ACSC_ACEXY 617 23 -
RGVAVADLFRQRGDMLHAHMALRIA BCSC_ACEXY 632 23 -
RGVAVADLFRQRGDMVHARMALRIA O82861 617 23 -
RGVAVADLFRQRGDMIHARMALRIA Q9WX63 618 23 -

Motif 10 width=19
Element Seqn Id St Int Rpt
YMKISNPVAAARLLAPLGD ACSC_ACEXY 660 18 -
YMKISNPVAAARLLAPLGD BCSC_ACEXY 675 18 -
YMKISNPVAAARLLAPLGD O82861 660 18 -
YMKISNPVAAARLLAPLGD Q9WX63 661 18 -

Motif 11 width=29
Element Seqn Id St Int Rpt
KALEIDLAVLRHNPQDLDARQAAVQAAVN ACSC_ACEXY 753 74 -
HALDIDLAVLRHNPQDLDARQAAVQAAAN BCSC_ACEXY 768 74 -
KALEIDLAVLRHNPQDLDARQAAVQAAVN O82861 753 74 -
KALDIDLAVLRHNPQDLDARQAAVQAAVN Q9WX63 754 74 -

Motif 12 width=30
Element Seqn Id St Int Rpt
WLAMAVADQADGHGQRTIEDLRRAYDLRLQ ACSC_ACEXY 806 24 -
WLGMAVADRAVGHGDRTLADLRRAYELRLQ BCSC_ACEXY 821 24 -
WLAMAVADQADGHGQRTIEDLRRAYDLRLQ O82861 806 24 -
WLGMAVADQADGHGHRTIADLRRAYDLRLQ Q9WX63 807 24 -

Motif 13 width=24
Element Seqn Id St Int Rpt
GQVEATLGNTILYGGGGYAIQTGK ACSC_ACEXY 1111 275 -
GQVEATLGNTIVYGGGGYAIQTGH BCSC_ACEXY 1103 252 -
GQVEATLGNTILYGGGGYAIQTGK O82861 1118 282 -
GQVEATLGNTILYGGGGYAIQTGK Q9WX63 1117 280 -

Motif 14 width=25
Element Seqn Id St Int Rpt
YFGYAKNEDFYTYGQGGYFSPQSYY ACSC_ACEXY 1168 33 -
YFGYKHNEDFYTYGQGGYFSPQSYF BCSC_ACEXY 1160 33 -
YFGYAHNEDFYTYGQGGYFSPQSYY O82861 1175 33 -
YFGYANNQDFYTYGQGGYFSPQSYY Q9WX63 1174 33 -

Motif 15 width=22
Element Seqn Id St Int Rpt
DWDVTGSVGYQVFHEHSAPFFP ACSC_ACEXY 1208 15 -
DWDVTGSIGYQLFHEHSSAFFP BCSC_ACEXY 1200 15 -
DWDVTGSVGYQVFHEHAAPFFP O82861 1215 15 -
DWDVTGSVGYQVFHEHSSPFFP Q9WX63 1214 15 -