SPRINT Home UMBER Home Contents Standard Search Advanced Search Relation Search

==SPRINT==> PRINTS View



  selected as


PR00205

Identifier
CADHERIN  [View Relations]  [View Alignment]  
Accession
PR00205
No. of Motifs
7
Creation Date
09-JUN-1993  (UPDATE 28-MAY-2001)
Title
Cadherin signature
Database References

PROSITE; PS00232 CADHERIN
BLOCKS; BL00232
PFAM; PF00028 cadherin; PF01049 Cadherin_C_term
INTERPRO; IPR002126
Literature References
1. LIAW, C.W., CANNON, C., POWER, M.D., KIBONEKA, P.K. AND RUBIN, L.L.
Identification and cloning of 2 species of cadherins in bovine endothelial
cells.
EMBO J. 9(9) 2701-2708 (1990).
 
2. GINSBERG, D., DESIMONE, D. AND GEIGER, B.
Expression of a novel cadherin (EP-cadherin) in unfertilized eggs and early
Xenopus embryos.
DEVELOPMENT 111(2) 315-325 (1991).
 
3. WALSH, F.S., BARTON, C.H., PUTT, W., MOORE, S.E., KELSELL, D., SPURR, N.
AND GOODFELLOW, P.N.
N-Cadherin gene maps to human chromosome 18 and is not linked to the 
E-cadherin gene.
J.NEUROCHEM. 55(3) 805-812 (1990).

Documentation
Cadherins, first discovered in mouse teratocarcinoma cells [1], are 
structurally and functionally similar molecules [2] that take part in 
selective calcium-dependent adhesion interactions between cell surfaces
[3]. There are a number of different isoforms distributed in a tissue-
specific manner in a wide variety of organisms. Cells containing different 
cadherins tend to segregate in vitro, while those that contain the same 
cadherins tend to preferentially aggregate together. This observation is 
linked to the finding that cadherin expression causes morphological changes
involving the positional segregation of cells into layers, suggesting they 
may play an important role in the sorting of different cell types during 
morphogenesis, histogenesis and regeneration. They may also be involved in 
the regulation of tight and gap junctions, and in the control of 
intercellular spacing.
 
Structurally, cadherins comprise a number of domains: these include a
signal sequence; a propeptide of around 130 residues; an extracellular 
domain of around 600 residues; a single transmembrane domain; and a 
well-conserved C-terminal cytoplasmic domain of about 150 residues. 
The extracellular domain can be subdivided into 5 parts, 4 of which are 
repeats of about 110 residues, and the fifth contains 4 conserved
cysteines. The calcium-binding region of cadherins is thought to be located
in the extracellular domain.
 
CADHERIN is a 7-element fingerprint that provides a signature for the 
cadherins. The fingerprint was derived from an initial alignment of 34
sequences: the motifs were drawn from the N-terminal half of the alignment -
motif 1 lies in the first cadherin repeat; motifs 2-4 lie in the second
repeat; motifs 5 and 6 lie in the third repeat; and motif 7 lies at the
C-terminus of the fourth repeat. Eight iterations on SPTR39_15f were
required to reach convergence, at which point a true set comprising 205
sequences was identified. Numerous partial matches were also found, all of
which are cadherins or cadherin-related proteins that fail to match one or
more motifs.
Summary Information
 205 codes involving  7 elements
10 codes involving 6 elements
10 codes involving 5 elements
7 codes involving 4 elements
7 codes involving 3 elements
7 codes involving 2 elements
Composite Feature Index
7205205205205205205205
6896108109
58867399
45425354
32305236
21113323
1234567
True Positives
CAD1_CHICK    CAD1_HUMAN    CAD1_MOUSE    CAD1_XENLA    
CAD2_CHICK CAD2_HUMAN CAD2_MOUSE CAD3_HUMAN
CAD3_MOUSE CAD4_CHICK CAD4_MOUSE CAD5_HUMAN
CAD5_MOUSE CAD6_HUMAN CAD6_MOUSE CAD6_RAT
CAD8_HUMAN CAD8_MOUSE CADA_CHICK CADB_HUMAN
CADB_MOUSE CADB_XENLA CADC_HUMAN CADD_CHICK
CADD_HUMAN CADE_HUMAN CADF_XENLA CADL_RAT
CADN_XENLA CADO_XENLA DSC1_BOVIN DSC1_HUMAN
DSC1_MOUSE DSC2_HUMAN DSC2_MOUSE DSG3_HUMAN
FATH_HUMAN FAT_DROME O01912 O08963
O13129 O14917 O15039 O15053
O15943 O35161 O35542 O54800
O55134 O57537 O60245 O60246
O60247 O60330 O60622 O75277
O75278 O75279 O75280 O75281
O75282 O75283 O75284 O75285
O75286 O75287 O75288 O88185
O88277 O88278 O88689 O88690
O93264 O93319 O93508 O93509
O95206 P79883 Q08174 Q08192
Q12864 Q15066 Q15855 Q19319
Q19482 Q24292 Q63315 Q63418
Q63561 Q90275 Q90762 Q90763
Q91353 Q91838 Q9NPG4 Q9NRJ8
Q9NRT7 Q9NRT8 Q9NRU2 Q9NYQ6
Q9NYQ7 Q9NYQ8 Q9P2X5 Q9R0M0
Q9R0T4 Q9R100 Q9TWY4 Q9UII7
Q9UJ99 Q9ULB2 Q9ULB4 Q9ULB5
Q9UN63 Q9UN64 Q9UN65 Q9UN66
Q9UN67 Q9UN70 Q9UN71 Q9UN72
Q9UN73 Q9UN74 Q9UN75 Q9V5N8
Q9VAF5 Q9VEU1 Q9VFH5 Q9VGG5
Q9VVG0 Q9VW71 Q9WTP5 Q9WTR5
Q9WU10 Q9WVR2 Q9XWM6 Q9Y5C2
Q9Y5C3 Q9Y5C4 Q9Y5C5 Q9Y5C6
Q9Y5C7 Q9Y5C8 Q9Y5C9 Q9Y5D0
Q9Y5D1 Q9Y5D2 Q9Y5D3 Q9Y5D4
Q9Y5D5 Q9Y5D6 Q9Y5D7 Q9Y5D8
Q9Y5D9 Q9Y5E0 Q9Y5E1 Q9Y5E2
Q9Y5E3 Q9Y5E4 Q9Y5E5 Q9Y5E6
Q9Y5E7 Q9Y5E8 Q9Y5E9 Q9Y5F0
Q9Y5F1 Q9Y5F2 Q9Y5F3 Q9Y5F4
Q9Y5F5 Q9Y5F6 Q9Y5F7 Q9Y5F8
Q9Y5F9 Q9Y5G0 Q9Y5G1 Q9Y5G2
Q9Y5G3 Q9Y5G4 Q9Y5G5 Q9Y5G6
Q9Y5G7 Q9Y5G8 Q9Y5G9 Q9Y5H0
Q9Y5H1 Q9Y5H2 Q9Y5H3 Q9Y5H4
Q9Y5H5 Q9Y5H6 Q9Y5H7 Q9Y5H8
Q9Y5H9 Q9Y5I0 Q9Y5I1 Q9Y5I2
Q9Y5I3 Q9Y5I4 Q9Y5I5 Q9Y6N8
Q9Z0M3 Q9Z1B0 Q9Z1B1 Q9Z1Y3
YOG7_CAEEL
True Positive Partials
Codes involving 6 elements
CAD4_HUMAN CAD5_PIG DSC3_BOVIN DSC3_HUMAN
DSG2_HUMAN O01909 O55122 O61230
Q9JKP3 Q9NXU8
Codes involving 5 elements
CADF_HUMAN CADF_MOUSE DSG1_HUMAN O75309
O88338 O95883 Q24298 Q28634
Q9TYW6 Q9UII8
Codes involving 4 elements
DSG1_BOVIN O62328 P73089 Q19194
Q21035 Q9TS15 Q9VGW1
Codes involving 3 elements
O76356 Q17281 Q9NL47 Q9NXP8
Q9VBV7 Q9XY09 Q9YH35
Codes involving 2 elements
O44327 O94831 O94985 P81137
P91261 Q9NX86 Q9VAF6
Sequence Titles
CAD1_CHICK  EPITHELIAL-CADHERIN PRECURSOR (E-CADHERIN) (LIVER CELL ADHESION MOLECULE) (L-CAM) - Gallus gallus (Chicken). 
CAD1_HUMAN EPITHELIAL-CADHERIN PRECURSOR (E-CADHERIN) (UVOMORULIN) (CAM 120/80) - Homo sapiens (Human).
CAD1_MOUSE EPITHELIAL-CADHERIN PRECURSOR (E-CADHERIN) (UVOMORULIN) (ARC-1) - Mus musculus (Mouse).
CAD1_XENLA EPITHELIAL-CADHERIN PRECURSOR (E-CADHERIN) (UVOMORULIN) - Xenopus laevis (African clawed frog).
CAD2_CHICK NEURAL-CADHERIN PRECURSOR (N-CADHERIN) - Gallus gallus (Chicken).
CAD2_HUMAN NEURAL-CADHERIN PRECURSOR (N-CADHERIN) - Homo sapiens (Human).
CAD2_MOUSE NEURAL-CADHERIN PRECURSOR (N-CADHERIN) - Mus musculus (Mouse).
CAD3_HUMAN PLACENTAL-CADHERIN PRECURSOR (P-CADHERIN) - Homo sapiens (Human).
CAD3_MOUSE PLACENTAL-CADHERIN PRECURSOR (P-CADHERIN) - Mus musculus (Mouse).
CAD4_CHICK RETINAL-CADHERIN PRECURSOR (R-CADHERIN) (R-CAD) - Gallus gallus (Chicken).
CAD4_MOUSE RETINAL-CADHERIN PRECURSOR (R-CADHERIN) (R-CAD) - Mus musculus (Mouse).
CAD5_HUMAN VASCULAR ENDOTHELIAL-CADHERIN PRECURSOR (VE-CADHERIN) (CADHERIN-5) (7B4 ANTIGEN) (CD144 ANTIGEN) - Homo sapiens (Human).
CAD5_MOUSE VASCULAR ENDOTHELIAL-CADHERIN PRECURSOR (VE-CADHERIN) (CADHERIN-5) - Mus musculus (Mouse).
CAD6_HUMAN CADHERIN-6 PRECURSOR (KIDNEY-CADHERIN) (K-CADHERIN) - Homo sapiens (Human).
CAD6_MOUSE CADHERIN-6 PRECURSOR (KIDNEY-CADHERIN) (K-CADHERIN) - Mus musculus (Mouse).
CAD6_RAT CADHERIN-6 PRECURSOR (KIDNEY-CADHERIN) (K-CADHERIN) - Rattus norvegicus (Rat).
CAD8_HUMAN CADHERIN-8 PRECURSOR - Homo sapiens (Human).
CAD8_MOUSE CADHERIN-8 PRECURSOR - Mus musculus (Mouse).
CADA_CHICK CADHERIN-10 PRECURSOR - Gallus gallus (Chicken).
CADB_HUMAN CADHERIN-11 PRECURSOR (OSTEOBLAST-CADHERIN) (OB-CADHERIN) (OSF-4) - Homo sapiens (Human).
CADB_MOUSE CADHERIN-11 PRECURSOR (OSTEOBLAST-CADHERIN) (OB-CADHERIN) (OSF-4) - Mus musculus (Mouse).
CADB_XENLA BLASTOMERE-CADHERIN PRECURSOR (B-CADHERIN) - Xenopus laevis (African clawed frog).
CADC_HUMAN BRAIN-CADHERIN PRECURSOR (BR-CADHERIN) (CADHERIN-12) (N-CADHERIN 2) (CADHERIN, NEURAL TYPE, 2) - Homo sapiens (Human).
CADD_CHICK T-CADHERIN PRECURSOR (TRUNCATED-CADHERIN) (CADHERIN-13) - Gallus gallus (Chicken).
CADD_HUMAN T-CADHERIN PRECURSOR (TRUNCATED-CADHERIN) (CADHERIN-13) (H-CADHERIN) (HEART-CADHERIN) - Homo sapiens (Human).
CADE_HUMAN CADHERIN-14 PRECURSOR - HOMO SAPIENS (HUMAN).
CADF_XENLA EP-CADHERIN PRECURSOR (C-CADHERIN) - Xenopus laevis (African clawed frog).
CADL_RAT LIVER-INTESTINE-CADHERIN PRECURSOR (LI-CADHERIN) (CADHERIN-17) - Rattus norvegicus (Rat).
CADN_XENLA NEURAL-CADHERIN 1 PRECURSOR (N-CADHERIN 1) - Xenopus laevis (African clawed frog).
CADO_XENLA NEURAL-CADHERIN 2 PRECURSOR (N-CADHERIN 2) - Xenopus laevis (African clawed frog).
DSC1_BOVIN Desmocollin 1A/1B precursor (Desmosomal glycoprotein 2/3) (DG2/DG3) - Bos taurus (Bovine).
DSC1_HUMAN Desmocollin 1A/1B precursor (Desmosomal glycoprotein 2/3) (DG2/DG3) - Homo sapiens (Human).
DSC1_MOUSE Desmocollin 1A/1B precursor - Mus musculus (Mouse).
DSC2_HUMAN Desmocollin 2A/2B precursor (Desmosomal glycoprotein II and III) (Desmocollin-3) - Homo sapiens (Human).
DSC2_MOUSE Desmocollin 2A/2B precursor (Epithelial type 2 desmocollin) - Mus musculus (Mouse).
DSG3_HUMAN Desmoglein 3 precursor (130 kDa pemphigus vulgaris antigen) (PVA) - Homo sapiens (Human).
FATH_HUMAN CADHERIN-RELATED TUMOR SUPPRESSOR HOMOLOG PRECURSOR (FAT PROTEIN HOMOLOG) - HOMO SAPIENS (HUMAN).
FAT_DROME CADHERIN-RELATED TUMOR SUPPRESSOR PRECURSOR (FAT PROTEIN) - Drosophila melanogaster (Fruit fly).
O01912 SIMILARITY TO MULTIPLE CADHERIN-TYPE REPEATS - Caenorhabditis elegans.
O08963 PROTOCADHERIN 4 - Rattus norvegicus (Rat).
O13129 PROTOCADHERIN2 (PCDH2), COMPLETE CDS - Gallus gallus (Chicken).
O14917 PROTOCADHERIN 68 - Homo sapiens (Human).
O15039 KIAA0327 PROTEIN - Homo sapiens (Human).
O15053 KIAA0345 - Homo sapiens (Human).
O15943 NEURAL-CADHERIN PRECURSOR (CADHERIN-N PROTEIN) (DN-CADHERIN) - Drosophila melanogaster (Fruit fly).
O35161 SEVEN-PASS TRANSMEMBRANE RECEPTOR PRECURSOR - Mus musculus (Mouse).
O35542 CADHERIN-5 - Mus musculus (Mouse).
O54800 CADHERIN-8 PRECURSOR - Rattus norvegicus (Rat).
O55134 PROTOCADHERIN-4 - Mus musculus (Mouse).
O57537 NF-PROTOCADHERIN - Xenopus laevis (African clawed frog).
O60245 PCDH7 (BH-PCDH)A - Homo sapiens (Human).
O60246 PCDH7 (BH-PCDH)B - Homo sapiens (Human).
O60247 PCDH7 (BH-PCDH)C - Homo sapiens (Human).
O60330 KIAA0588 PROTEIN - Homo sapiens (Human).
O60622 PROTOCADHERIN 43 - Homo sapiens (Human).
O75277 KIAA0345-LIKE 1 - Homo sapiens (Human).
O75278 KIAA0345-LIKE 2 - Homo sapiens (Human).
O75279 KIAA0345-LIKE 3 - Homo sapiens (Human).
O75280 KIAA0345-LIKE 4 - Homo sapiens (Human).
O75281 KIAA0345-LIKE 6 - Homo sapiens (Human).
O75282 KIAA0345-LIKE 7 - Homo sapiens (Human).
O75283 KIAA0345-LIKE 8 - Homo sapiens (Human).
O75284 KIAA0345-LIKE 9 - Homo sapiens (Human).
O75285 KIAA0345-LIKE 10 - Homo sapiens (Human).
O75286 KIAA0345-LIKE 11 - Homo sapiens (Human).
O75287 KIAA0345-LIKE 12 - Homo sapiens (Human).
O75288 KIAA0345-LIKE 13 - Homo sapiens (Human).
O88185 BH-PROTOCADHERIN-A - Mus musculus (Mouse).
O88277 MEGF1 - Rattus norvegicus (Rat).
O88278 MEGF2 - Rattus norvegicus (Rat).
O88689 CNR1 - Mus musculus (Mouse).
O88690 CNR2 - Mus musculus (Mouse).
O93264 CADHERIN-11 PRECURSOR (OSTEOBLAST-CADHERIN) (OB-CADHERIN) - Xenopus laevis (African clawed frog).
O93319 CADHERIN-11 PRECURSOR (OSTEOBLAST-CADHERIN) (OB-CADHERIN) (OSF-4) - Gallus gallus (Chicken).
O93508 PARAXIAL PROTOCADHERIN - Brachydanio rerio (Zebrafish) (Zebra danio).
O93509 PARAXIAL PROTOCADHERIN - Xenopus laevis (African clawed frog).
O95206 PROTOCADHERIN - Homo sapiens (Human).
P79883 MATERNALLY EXPRESSED NEURAL CADHERIN XMN-CADHERIN - Xenopus.
Q08174 PROTOCADHERIN 1 PRECURSOR (PROTOCADHERIN 42) (PC42) (CADHERIN-LIKE PROTEIN 1) - Homo sapiens (Human).
Q08192 PROTOCADHERIN 43 PRECURSOR (PC43) (CADHERIN-LIKE PROTEIN) - Homo sapiens (Human).
Q12864 LIVER-INTESTINE-CADHERIN PRECURSOR (LI-CADHERIN) (CADHERIN-17) (INTESTINAL PEPTIDE-ASSOCIATED TRANSPORTER HPT-1) - Homo sapiens (Human).
Q15066 OB-CADHERIN-2 - Homo sapiens (Human).
Q15855 UVOMORULIN PRECURSOR (E-CADHERIN) (ARC-1/UVOMORULIN) - Homo sapiens (Human).
Q19319 HYPOTHETICAL 479.0 KDA PROTEIN F25F2.2 IN CHROMOSOME III - Caenorhabditis elegans.
Q19482 F15B9.7 PROTEIN - Caenorhabditis elegans.
Q24292 DACHSOUS PROTEIN PRECURSOR (ADHERIN) - Drosophila melanogaster (Fruit fly).
Q63315 LONG TYPE PB-CADHERIN - Rattus norvegicus (Rat).
Q63418 PROTOCADHERIN 3 - Rattus norvegicus (Rat).
Q63561 SHORT TYPE PB-CADHERIN - Rattus norvegicus (Rat).
Q90275 NEURAL-CADHERIN PRECURSOR (N-CADHERIN) - Brachydanio rerio (Zebrafish) (Zebra danio).
Q90762 CADHERIN-6 PRECURSOR (KIDNEY-CADHERIN) (K-CADHERIN) (CADHERIN-6B) - Gallus gallus (Chicken).
Q90763 CHICKEN CADHERIN-7 - Gallus gallus (Chicken).
Q91353 T-CADHERIN 2 - Gallus gallus (Chicken).
Q91838 F-CADHERIN - Xenopus laevis (African clawed frog).
Q9NPG4 VASCULAR CADHERIN-2 (PROTOCADHERIN 12) (VASCULAR ENDOTHELIAL CADHERIN 2) - Homo sapiens (Human).
Q9NRJ8 PROTOCADHERIN 3H - Homo sapiens (Human).
Q9NRT7 PROTOCADHERIN ALPHA 1 ALTERNATE ISOFORM - Homo sapiens (Human).
Q9NRT8 PROTOCADHERIN ALPHA 6 ALTERNATE ISOFORM - Homo sapiens (Human).
Q9NRU2 PROTOCADHERIN ALPHA 10 ALTERNATE ISOFORM - Homo sapiens (Human).
Q9NYQ6 PROTOCADHERIN FLAMINGO 2 - Homo sapiens (Human).
Q9NYQ7 PROTOCADHERIN FLAMINGO 1 - Homo sapiens (Human).
Q9NYQ8 PROTOCADHERIN FAT 2 - Homo sapiens (Human).
Q9P2X5 PROTOCADHERIN-XA - Homo sapiens (Human).
Q9R0M0 FLAMINGO 1 - Mus musculus (Mouse).
Q9R0T4 EPITHELIAL-CADHERIN PRECURSOR (E-CADHERIN) (UVOMORULIN) (CAM 120/80) - Rattus norvegicus (Rat).
Q9R100 LIVER-INTESTINE-CADHERIN PRECURSOR (LI-CADHERIN) (CADHERIN-17) (BILL- CADHERIN) (P130) - Mus musculus (Mouse).
Q9TWY4 CADHERIN 3 - Caenorhabditis elegans.
Q9UII7 E-CADHERIN - Homo sapiens (Human).
Q9UJ99 DJ998H6.1 (ORTHOLOG OF RAT PB-CADHERIN) - Homo sapiens (Human).
Q9ULB2 CADHERIN-8 - Homo sapiens (Human).
Q9ULB4 CADHERIN-9 PRECURSOR - Homo sapiens (Human).
Q9ULB5 CADHERIN-7 - Homo sapiens (Human).
Q9UN63 PROTOCADHERIN GAMMA B7 SHORT FORM PROTEIN - Homo sapiens (Human).
Q9UN64 PROTOCADHERIN GAMMA B4 SHORT FORM PROTEIN - Homo sapiens (Human).
Q9UN65 PROTOCADHERIN GAMMA B2 SHORT FORM PROTEIN - Homo sapiens (Human).
Q9UN66 PROTOCADHERIN BETA 8 - Homo sapiens (Human).
Q9UN67 PROTOCADHERIN BETA 10 - Homo sapiens (Human).
Q9UN70 PROTOCADHERIN GAMMA C3 - Homo sapiens (Human).
Q9UN71 PROTOCADHERIN GAMMA B4 - Homo sapiens (Human).
Q9UN72 PROTOCADHERIN ALPHA 7 - Homo sapiens (Human).
Q9UN73 PROTOCADHERIN ALPHA 6 - Homo sapiens (Human).
Q9UN74 PROTOCADHERIN ALPHA 4 - Homo sapiens (Human).
Q9UN75 PROTOCADHERIN ALPHA 12 - Homo sapiens (Human).
Q9V5N8 PROTOCADHERIN-LIKE WING POLARITY PROTEIN STAN PRECURSOR (STARRY NIGHT PROTEIN) (FLAMINGO PROTEIN) - Drosophila melanogaster (Fruit fly).
Q9VAF5 PUTATIVE CADHERIN PRECURSOR (CG7805 PROTEIN) - Drosophila melanogaster (Fruit fly).
Q9VEU1 PUTATIVE CADHERIN PRECURSOR (CG14900 PROTEIN) - Drosophila melanogaster (Fruit fly).
Q9VFH5 PUTATIVE CADHERIN PRECURSOR (CG3389 PROTEIN) - Drosophila melanogaster (Fruit fly).
Q9VGG5 PUTATIVE CADHERIN PRECURSOR - Drosophila melanogaster (Fruit fly).
Q9VVG0 PUTATIVE CADHERIN PRECURSOR (CG6445 PROTEIN) - Drosophila melanogaster (Fruit fly).
Q9VW71 PUTATIVE FAT-LIKE CADHERIN PRECURSOR (CG7749 PROTEIN) - Drosophila melanogaster (Fruit fly).
Q9WTP5 PB-CADHERIN - Mus musculus (Mouse).
Q9WTR5 T-CADHERIN PRECURSOR (TRUNCATED-CADHERIN) (CADHERIN-13) (H-CADHERIN) (HEART-CADHERIN) - Mus musculus (Mouse).
Q9WU10 PROTOCADHERIN - Rattus norvegicus (Rat).
Q9WVR2 ARCADLIN - Rattus norvegicus (Rat).
Q9XWM6 Y52B11B.2 PROTEIN - Caenorhabditis elegans.
Q9Y5C2 PROTOCADHERIN GAMMA C5 SHORT FORM PROTEIN - Homo sapiens (Human).
Q9Y5C3 PROTOCADHERIN GAMMA C4 SHORT FORM PROTEIN - Homo sapiens (Human).
Q9Y5C4 PROTOCADHERIN GAMMA C3 SHORT FORM PROTEIN - Homo sapiens (Human).
Q9Y5C5 PROTOCADHERIN GAMMA B6 SHORT FORM PROTEIN - Homo sapiens (Human).
Q9Y5C6 PROTOCADHERIN GAMMA B5 SHORT FORM PROTEIN - Homo sapiens (Human).
Q9Y5C7 PROTOCADHERIN GAMMA B3 SHORT FORM PROTEIN - Homo sapiens (Human).
Q9Y5C8 PROTOCADHERIN GAMMA B1 SHORT FORM PROTEIN - Homo sapiens (Human).
Q9Y5C9 PROTOCADHERIN GAMMA A9 SHORT FORM PROTEIN - Homo sapiens (Human).
Q9Y5D0 PROTOCADHERIN GAMMA A7 SHORT FORM PROTEIN - Homo sapiens (Human).
Q9Y5D1 PROTOCADHERIN GAMMA A6 SHORT FORM PROTEIN - Homo sapiens (Human).
Q9Y5D2 PROTOCADHERIN GAMMA A5 SHORT FORM PROTEIN - Homo sapiens (Human).
Q9Y5D3 PROTOCADHERIN GAMMA A4 SHORT FORM PROTEIN - Homo sapiens (Human).
Q9Y5D4 PROTOCADHERIN GAMMA A3 SHORT FORM PROTEIN - Homo sapiens (Human).
Q9Y5D5 PROTOCADHERIN GAMMA A2 SHORT FORM PROTEIN - Homo sapiens (Human).
Q9Y5D6 PROTOCADHERIN GAMMA A1 SHORT FORM PROTEIN - Homo sapiens (Human).
Q9Y5D7 PROTOCADHERIN GAMMA A12 SHORT FORM PROTEIN - Homo sapiens (Human).
Q9Y5D8 PROTOCADHERIN GAMMA A11 SHORT FORM PROTEIN - Homo sapiens (Human).
Q9Y5D9 PROTOCADHERIN GAMMA A11 - Homo sapiens (Human).
Q9Y5E0 PROTOCADHERIN GAMMA A10 SHORT FORM PROTEIN - Homo sapiens (Human).
Q9Y5E1 PROTOCADHERIN BETA 9 - Homo sapiens (Human).
Q9Y5E2 PROTOCADHERIN BETA 7 - Homo sapiens (Human).
Q9Y5E3 PROTOCADHERIN BETA 6 - Homo sapiens (Human).
Q9Y5E4 PROTOCADHERIN BETA 5 - Homo sapiens (Human).
Q9Y5E5 PROTOCADHERIN BETA 4 - Homo sapiens (Human).
Q9Y5E6 PROTOCADHERIN BETA 3 - Homo sapiens (Human).
Q9Y5E7 PROTOCADHERIN BETA 2 - Homo sapiens (Human).
Q9Y5E8 PROTOCADHERIN BETA 15 - Homo sapiens (Human).
Q9Y5E9 PROTOCADHERIN BETA 14 - Homo sapiens (Human).
Q9Y5F0 PROTOCADHERIN BETA 13 - Homo sapiens (Human).
Q9Y5F1 PROTOCADHERIN BETA 12 - Homo sapiens (Human).
Q9Y5F2 PROTOCADHERIN BETA 11 - Homo sapiens (Human).
Q9Y5F3 PROTOCADHERIN BETA 1 - Homo sapiens (Human).
Q9Y5F4 PROTOCADHERIN ALPHA C2 SHORT FORM PROTEIN - Homo sapiens (Human).
Q9Y5F5 PROTOCADHERIN ALPHA C1 SHORT FORM PROTEIN - Homo sapiens (Human).
Q9Y5F6 PROTOCADHERIN GAMMA C5 - Homo sapiens (Human).
Q9Y5F7 PROTOCADHERIN GAMMA C4 - Homo sapiens (Human).
Q9Y5F8 PROTOCADHERIN GAMMA B7 - Homo sapiens (Human).
Q9Y5F9 PROTOCADHERIN GAMMA B6 - Homo sapiens (Human).
Q9Y5G0 PROTOCADHERIN GAMMA B5 - Homo sapiens (Human).
Q9Y5G1 PROTOCADHERIN GAMMA B3 - Homo sapiens (Human).
Q9Y5G2 PROTOCADHERIN GAMMA B2 - Homo sapiens (Human).
Q9Y5G3 PROTOCADHERIN GAMMA B1 - Homo sapiens (Human).
Q9Y5G4 PROTOCADHERIN GAMMA A9 - Homo sapiens (Human).
Q9Y5G5 PROTOCADHERIN GAMMA A8 - Homo sapiens (Human).
Q9Y5G6 PROTOCADHERIN GAMMA A7 - Homo sapiens (Human).
Q9Y5G7 PROTOCADHERIN GAMMA A6 - Homo sapiens (Human).
Q9Y5G8 PROTOCADHERIN GAMMA A5 - Homo sapiens (Human).
Q9Y5G9 PROTOCADHERIN GAMMA A4 - Homo sapiens (Human).
Q9Y5H0 PROTOCADHERIN GAMMA A3 - Homo sapiens (Human).
Q9Y5H1 PROTOCADHERIN GAMMA A2 - Homo sapiens (Human).
Q9Y5H2 PROTOCADHERIN GAMMA A11 - Homo sapiens (Human).
Q9Y5H3 PROTOCADHERIN GAMMA A10 - Homo sapiens (Human).
Q9Y5H4 PROTOCADHERIN GAMMA A1 - Homo sapiens (Human).
Q9Y5H5 PROTOCADHERIN ALPHA 9 - Homo sapiens (Human).
Q9Y5H6 PROTOCADHERIN ALPHA 8 - Homo sapiens (Human).
Q9Y5H7 PROTOCADHERIN ALPHA 5 - Homo sapiens (Human).
Q9Y5H8 PROTOCADHERIN ALPHA 3 - Homo sapiens (Human).
Q9Y5H9 PROTOCADHERIN ALPHA 2 - Homo sapiens (Human).
Q9Y5I0 PROTOCADHERIN ALPHA 13 - Homo sapiens (Human).
Q9Y5I1 PROTOCADHERIN ALPHA 11 - Homo sapiens (Human).
Q9Y5I2 PROTOCADHERIN ALPHA 10 - Homo sapiens (Human).
Q9Y5I3 PROTOCADHERIN ALPHA 1 - Homo sapiens (Human).
Q9Y5I4 PROTOCADHERIN ALPHA C2 - Homo sapiens (Human).
Q9Y5I5 PROTOCADHERIN ALPHA C1 - Homo sapiens (Human).
Q9Y6N8 CADHERIN-10 PRECURSOR - Homo sapiens (Human).
Q9Z0M3 CADHERIN 7 PRECURSOR - Mus musculus (Mouse).
Q9Z1B0 PROTOCADHERIN X - Mus musculus (Mouse).
Q9Z1B1 OL-PROTOCADHERIN - Mus musculus (Mouse).
Q9Z1Y3 NEURAL-CADHERIN PRECURSOR (N-CADHERIN) - Rattus norvegicus (Rat).
YOG7_CAEEL HYPOTHETICAL 375.7 KDA PROTEIN ZK112.7 IN CHROMOSOME III PRECURSOR - Caenorhabditis elegans.

CAD4_HUMAN RETINAL-CADHERIN PRECURSOR (R-CADHERIN) (R-CAD) - Homo sapiens (Human).
CAD5_PIG VASCULAR ENDOTHELIAL-CADHERIN PRECURSOR (VE-CADHERIN) (CADHERIN-5) - Sus scrofa (Pig).
DSC3_BOVIN Desmocollin 3A/3B precursor - Bos taurus (Bovine).
DSC3_HUMAN Desmocollin 3 precursor (Desmocollin 4) (HT-CP) - Homo sapiens (Human).
DSG2_HUMAN Desmoglein 2 precursor (HDGC) - Homo sapiens (Human).
O01909 SIMILARITY TO MULTIPLE CADHERIN-TYPE REPEATS - Caenorhabditis elegans.
O55122 DESMOCOLLIN 3 PRECURSOR (MDSC3) (MDSC3A) - Mus musculus (Mouse).
O61230 G-CADHERIN - Lytechinus variegatus (Sea urchin).
Q9JKP3 PARAXIAL PROTOCADHERIN - Mus musculus (Mouse).
Q9NXU8 CDNA FLJ20047 FIS, CLONE COL00577 - Homo sapiens (Human).

CADF_HUMAN MUSCLE-CADHERIN PRECURSOR (M-CADHERIN) (CADHERIN-15) (CADHERIN-14) - Homo sapiens (Human).
CADF_MOUSE MUSCLE-CADHERIN PRECURSOR (M-CADHERIN) (CADHERIN-15) (CADHERIN-14) - Mus musculus (Mouse).
DSG1_HUMAN Desmoglein 1 precursor (Desmosomal glycoprotein 1) (DG1) (DGI) (Pemphigus foliaceus antigen) - Homo sapiens (Human).
O75309 KSP-CADHERIN - Homo sapiens (Human).
O88338 KSP-CADHERIN - Mus musculus (Mouse).
O95883 SIMILAR TO PROTOCADHERIN-3 (PCDH3) - Homo sapiens (Human).
Q24298 DE-CADHERIN PRECURSOR (SHOTGUN PROTEIN) - Drosophila melanogaster (Fruit fly).
Q28634 KIDNEY-SPECIFIC CADHERIN PRECURSOR (KSP-CADHERIN) - Oryctolagus cuniculus (Rabbit).
Q9TYW6 Y66H1B.1 PROTEIN - Caenorhabditis elegans.
Q9UII8 E-CADHERIN - Homo sapiens (Human).

DSG1_BOVIN Desmoglein 1 precursor (Desmosomal glycoprotein 1) (DG1) (DGI) (Pemphigus foliaceus antigen) - Bos taurus (Bovine).
O62328 R05H10.6 PROTEIN - Caenorhabditis elegans.
P73089 FAT PROTEIN - Synechocystis sp. (strain PCC 6803).
Q19194 SIMILAR TO DROSOPHILA CADHERIN-RELATED TUMOR SUPPRESSOR - Caenorhabditis elegans.
Q21035 SIMILAR TO CADHERIN-TYPE REPEAT. NCBI GI: 1086762 - Caenorhabditis elegans.
Q9TS15 PEMPHIGUS FOLIACEUS ANTIGEN, DESMOSOMAL CADHERIN, DSG1=DSG1 GENE PRODUCT - Bos taurus (Bovine).
Q9VGW1 PUTATIVE CADHERIN PRECURSOR (CG4509 PROTEIN) - Drosophila melanogaster (Fruit fly).

O76356 C45G7.6 PROTEIN - Caenorhabditis elegans.
Q17281 CADHERIN HOMOLOG - Botryllus schlosseri.
Q9NL47 CADHERIN - Ciona intestinalis.
Q9NXP8 CDNA FLJ20124 FIS, CLONE COL06056 - Homo sapiens (Human).
Q9VBV7 PUTATIVE CADHERIN PRECURSOR (CG10421 PROTEIN) - Drosophila melanogaster (Fruit fly).
Q9XY09 BTR175 PRECURSOR - Bombyx mori (Silk moth).
Q9YH35 RECEPTOR PROTEIN TYROSINE KINASE - Tetraodon fluviatilis (Puffer fish).

O44327 HMR-1 - Caenorhabditis elegans.
O94831 KIAA0726 PROTEIN - Homo sapiens (Human).
O94985 KIAA0911 PROTEIN - Homo sapiens (Human).
P81137 INSECTICIDAL TOXIN RECEPTOR BT-R1 PRECURSOR - Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm).
P91261 HYPOTHETICAL 35.4 KDA PROTEIN - Caenorhabditis elegans.
Q9NX86 CDNA FLJ20377 FIS, CLONE KAIA0462 - Homo sapiens (Human).
Q9VAF6 PUTATIVE CADHERIN PRECURSOR (CG15511 PROTEIN) - Drosophila melanogaster (Fruit fly).
Scan History
SPTR39_15f 8  1000 NSINGLE    
Initial Motifs
Motif 1  width=20
Element Seqn Id St Int Rpt
DLFIINENTGDIQATKRLDR CAD6_RAT 99 99 -
DLFIINENTGDIQATKRLDR CAD6_HUMAN 99 99 -
DLFIINEHTGDIQATKRLDR CAD6_MOUSE 99 99 -
TIFQINDITGDIHAIKRLDR CAD8_MOUSE 107 107 -
TIFQINDVTGDIHAIKRLDR CAD8_HUMAN 100 100 -
TLFIIDEKTGDIHATRRIDR CADA_CHICK 100 100 -
TIFVIDDKSGNIHATKTLDR CADB_HUMAN 99 99 -
TIFVIDDKSGNIHATKTLDR CADB_MOUSE 99 99 -
KVFRVDAETGDVFAIERLDR CAD5_HUMAN 91 91 -
GIFIINPISGQLSVTKPLDR CAD2_MOUSE 208 208 -
GIFIINPISGQLSVTKPLDR CAD2_CHICK 213 213 -
GIFIINPISGQLSVTKPLDR CAD2_HUMAN 208 208 -
GVFIIERETGWLKVTQPLDR CAD1_MOUSE 205 205 -
GVFIINPISGQLSVTKPLDR CADO_XENLA 209 209 -
GVFIIERETGWLKVTEPLDR CAD1_HUMAN 203 203 -
GVFIINPIGGQLSVTKPLDR CADN_XENLA 209 209 -
EVFSIDPVSGRMYVTRPMDR CAD4_CHICK 215 215 -
KIFGVDANTGNVLAYERLDR CAD5_MOUSE 88 88 -
TVFTIDETTGDIHAIRSLDR CADC_HUMAN 100 100 -
EVFNIDSMSGRMYVTRPMDR CAD4_MOUSE 215 215 -
GVFRIEWETGWMLVTRPLDR CADF_XENLA 219 219 -
GVFAIGREDGWLNVTRPLDR CAD1_XENLA 197 197 -
GIFIIERETGWLEVTEQLDR CAD1_CHICK 209 209 -
GIFRINEISGDVSVTRPLDR CADD_CHICK 186 186 -
GIFRIEKETGWMQVTRPLDR CADB_XENLA 227 227 -
GVFAVEKETGWLLLNKPLDR CAD3_HUMAN 156 156 -
GIFRINENTGSVSVTRTLDR CADD_HUMAN 186 186 -
NLFYVERDTGNLYCTGRVDR DSC2_MOUSE 184 184 -
NLFYIEKDTGDIYCTRSIDR DSC1_MOUSE 183 183 -
NLFYIEKDTGDIFCTRSIDR DSC1_HUMAN 183 183 -
GVFTIEKESGWLLLHMPLDR CAD3_MOUSE 148 148 -
NLFFIEKDTGDIFCTRSIDR DSC1_BOVIN 181 181 -
NLFYVERDTGNLYCTRPVDR DSC2_HUMAN 184 184 -
GIFVVDKNTGDINITAIVDR DSG3_HUMAN 98 98 -

Motif 2 width=30
Element Seqn Id St Int Rpt
FTKDVYTATVPEMADVGTFVVQVTATDADD CAD6_RAT 159 40 -
FTKEVYTATVPEMSDVGTFVVQVTATDADD CAD6_HUMAN 159 40 -
FTKDVYTATVPEMADVGTFVVQVTATDADD CAD6_MOUSE 159 40 -
FLNGPYHATVPEMSILGTSVTNVTATDADD CAD8_MOUSE 167 40 -
FLNGPYHATVPEMSILGTSVTNVTATDADD CAD8_HUMAN 160 40 -
FPEEIYTASVPEMSVVGTSVVQVTATDADD CADA_CHICK 160 40 -
FLHETYHANVPERSNVGTSVIQVTASDADD CADB_HUMAN 159 40 -
FLHEIYHANVPERSNVGTSVIQVTASDADD CADB_MOUSE 159 40 -
FTHRLFNASVPESSAVGTSVISVTAVDADD CAD5_HUMAN 151 40 -
FLHQVWNGSVPEGSKPGTYVMTVTAIDADD CAD2_MOUSE 267 39 -
FLHQVWNGTVPEGSKPGTYVMTVTAIDADD CAD2_CHICK 272 39 -
FLHQVWNGTVPEGSKPGTYVMTVTAIDADD CAD2_HUMAN 267 39 -
FTQEVFEGSVAEGAVPGTSVMKVSATDADD CAD1_MOUSE 264 39 -
FLHQIWNGTIPEGSKPGTYVMTVTAIDGDD CADO_XENLA 268 39 -
FTQEVFKGSVMEGALPGTSVMEVTATDADD CAD1_HUMAN 262 39 -
FLHQIWNGSIPEGSKPGTYVMTVTAIDGDD CADN_XENLA 268 39 -
FINQVYNGSVDEGSKPGTYVMTVTANDADD CAD4_CHICK 274 39 -
FSHQVFNASVPEMSAIGTSVIRVTAVDADD CAD5_MOUSE 148 40 -
FLDGPYVATVPEMSPVGAYVLQVKATDADD CADC_HUMAN 160 40 -
FINQVYNGSVDEGSKPGTYVMTVTANDADD CAD4_MOUSE 274 39 -
FTQDVFRGSVREGVQPGTQVMAVSATDEDD CADF_XENLA 278 39 -
FTQSVFEGSVPEGSKPGTAVMTVSATDADD CAD1_XENLA 256 39 -
FIKEVFVGYIEENAKPGTSVMTVNATDADD CAD1_CHICK 268 39 -
FKEGPYVGHVMEGSPTGTTVMRMTAFDADD CADD_CHICK 245 39 -
FTQPVFRGSVREGVQPGTKVMSVSATDDDD CADB_XENLA 286 39 -
FTQDTFRGSVLEGVLPGTSVMQVTATDEDD CAD3_HUMAN 215 39 -
FREGPYIGHVMEGSPTGTTVMRMTAFDADD CADD_HUMAN 245 39 -
FTQKLYSFTVQENSRIGSIVGEVCATDLDE DSC2_MOUSE 243 39 -
FETKLTVFSVPENCRSGTSVGQVTAIDKDE DSC1_MOUSE 242 39 -
FEHRVTIFTVPENCRSGTSVGKVTATDLDE DSC1_HUMAN 242 39 -
FTQDTFRGSVLEGVMPGTSVMQVTATDEDD CAD3_MOUSE 207 39 -
FENKLTVFTVPENCRTGTSVGKVTAIDLDE DSC1_BOVIN 240 39 -
FTEETYTFTIFENCRVGTTVGQVCATDKDE DSC2_HUMAN 243 39 -
FSQQIFMGEIEENSASNSLVMILNATDADE DSG3_HUMAN 157 39 -

Motif 3 width=13
Element Seqn Id St Int Rpt
QYQVVIQAKDMGG CAD6_RAT 231 42 -
QYQVVIQAKDMGG CAD6_HUMAN 231 42 -
QYQVVIQAKDMGG CAD6_MOUSE 231 42 -
EYLVVIQAIDMGG CAD8_MOUSE 239 42 -
EYLVVIQAKDMGG CAD8_HUMAN 232 42 -
QYQVVIQAKDMGG CADA_CHICK 232 42 -
EYHVVIQAKDMGG CADB_HUMAN 231 42 -
EYHVVIQAKDMGG CADB_MOUSE 231 42 -
RYEIVVEARDAQG CAD5_HUMAN 222 41 -
QYTLIIQATDMEG CAD2_MOUSE 344 47 -
QYTLIIQATDMEG CAD2_CHICK 349 47 -
QYTLIIQATDMEG CAD2_HUMAN 344 47 -
TYTLVVQAADLQG CAD1_MOUSE 342 48 -
RYTLIIQATDMEG CADO_XENLA 345 47 -
TYTLVVQAADLQG CAD1_HUMAN 340 48 -
RYTLIIQATDMEG CADN_XENLA 345 47 -
QYMVIVQATDMEG CAD4_CHICK 351 47 -
EYKIVVETQDALG CAD5_MOUSE 219 41 -
QYQVLIQAKDMGG CADC_HUMAN 232 42 -
QYTVIVQATDMEG CAD4_MOUSE 351 47 -
EYTLTVQATDLEG CADF_XENLA 356 48 -
VYTLTIQAADGEF CAD1_XENLA 334 48 -
NYTLIVQATDQEG CAD1_CHICK 346 48 -
KYELVIEAKDMGG CADD_CHICK 326 51 -
EYTLTVQAADLDG CADB_XENLA 364 48 -
EYTLTIQATDMDG CAD3_HUMAN 293 48 -
KYELIIEAQDMAG CADD_HUMAN 326 51 -
KYQLLIKVQDMDG DSC2_MOUSE 318 45 -
TYKLVMEVRDMGG DSC1_MOUSE 317 45 -
TYQLIMEVRDMGG DSC1_HUMAN 317 45 -
EYRLTVQATDMDG CAD3_MOUSE 285 48 -
TYKLIMEVRDMGG DSC1_BOVIN 315 45 -
KYQLKIKVQDMDG DSC2_HUMAN 318 45 -
SYRLVVSGADKDG DSG3_HUMAN 232 45 -

Motif 4 width=20
Element Seqn Id St Int Rpt
GLSGTTTVNITLTDVNDNPP CAD6_RAT 247 3 -
GLSGTTTVNITLTDVNDNPP CAD6_HUMAN 247 3 -
GLSGTTTVNITLTDVNDNPP CAD6_MOUSE 247 3 -
GLSGTTTLTVTLTDVNDNPP CAD8_MOUSE 255 3 -
GLSGTTTLTVTLTDVNDNPP CAD8_HUMAN 248 3 -
GLSGTTTVNITLTDVNDNPP CADA_CHICK 248 3 -
GLSGTTKVTITLTDVNDNPP CADB_HUMAN 247 3 -
GLSGTTKVTITLTDVNDNPP CADB_MOUSE 247 3 -
GDSGTATVLVTLQDINDNFP CAD5_HUMAN 237 2 -
GLSNTATAVITVTDVNDNPP CAD2_MOUSE 361 4 -
GLSNTATAVITVTDVNDNPP CAD2_CHICK 366 4 -
GLSNTATAVITVTDVNDNPP CAD2_HUMAN 361 4 -
GLSTTAKAVITVKDINDNAP CAD1_MOUSE 356 1 -
GLSNTATAVIAVTDVNDNPP CADO_XENLA 362 4 -
GLSTTATAVITVTDTNDNPP CAD1_HUMAN 354 1 -
GLSNTATAVIAVTDVNDNPP CADN_XENLA 362 4 -
GLSNTATAIITVTDVNDNPP CAD4_CHICK 368 4 -
GESGTATVMIRLEDINDNFP CAD5_MOUSE 234 2 -
GLAGTTIVNITLTDVNDNPP CADC_HUMAN 248 3 -
GLSNTATAIITVTDVNDNPP CAD4_MOUSE 368 4 -
GLSVEGKAIIQITDANDNAP CADF_XENLA 370 1 -
DRTTTATALIVVMDTNDNPP CAD1_XENLA 349 2 -
GLSNTATAIIEVTDANDNIP CAD1_CHICK 360 1 -
GLTGTATATILIDDKNDHPP CADD_CHICK 342 3 -
GLTAEGKAVIEITDANDNAP CADB_XENLA 378 1 -
GSTTTAVAVVEILDANDNAP CAD3_HUMAN 307 1 -
GLTGTATATIMIDDKNDHSP CADD_HUMAN 342 3 -
GLHTTAKCIITIEDVNDNLP DSC2_MOUSE 334 3 -
GLFTTGTITISLEDENDNSP DSC1_MOUSE 333 3 -
GLFNTGTITISLEDENDNPP DSC1_HUMAN 333 3 -
GSTTTAEAVVQILDANDNAP CAD3_MOUSE 299 1 -
GLFNTGTITISLEDENDNAP DSC1_BOVIN 331 3 -
GLQTTSTCIINIDDVNDHLP DSC2_HUMAN 334 3 -
GLSTQCECNIKVKDVNDNFP DSG3_HUMAN 246 1 -

Motif 5 width=14
Element Seqn Id St Int Rpt
PRFPQSTYQFKTPE CAD6_RAT 266 -1 -
PRFPQSTYQFKTPE CAD6_HUMAN 266 -1 -
PRFPQSTYQFKTPE CAD6_MOUSE 266 -1 -
PKFAQSLYHFSVPE CAD8_MOUSE 274 -1 -
PKFAQSLYHFSVPE CAD8_HUMAN 267 -1 -
PRFPQSTIHLRIPE CADA_CHICK 267 -1 -
PKFPQRLYQMSVSE CADB_HUMAN 266 -1 -
PKFPQSVYQMSVSE CADB_MOUSE 266 -1 -
PFFTQTKYTFVVPE CAD5_HUMAN 256 -1 -
PEFTAMTFYGEVPE CAD2_MOUSE 380 -1 -
PEFTAMTFYGEVPE CAD2_CHICK 385 -1 -
PEFTAMTFYGEVPE CAD2_HUMAN 380 -1 -
PVFNPSTYQGQVPE CAD1_MOUSE 375 -1 -
PEFTAMTFYGEVPE CADO_XENLA 381 -1 -
PIFNPTTYKGQVPE CAD1_HUMAN 373 -1 -
PEFTAMTFYGEVPE CADN_XENLA 381 -1 -
PEFTTSTYSGEVPE CAD4_CHICK 387 -1 -
PVFTQSTYTFSVPE CAD5_MOUSE 253 -1 -
PRFPKSIFHLKVPE CADC_HUMAN 267 -1 -
PEFTTSTFAGEVPE CAD4_MOUSE 387 -1 -
PIFDPKTYTALVPE CADF_XENLA 389 -1 -
PVFDPTQYTAKVPE CAD1_XENLA 368 -1 -
PIFNPTMYEGVVEE CAD1_CHICK 379 -1 -
PEFTKKEFQATVKE CADD_CHICK 361 -1 -
PIFDPKTYTALVPE CADB_XENLA 397 -1 -
PMFDPQKYEAHVPE CAD3_HUMAN 326 -1 -
PKFTKKEFQATVEE CADD_HUMAN 361 -1 -
PTFTRTTYVTSVEE DSC2_MOUSE 353 -1 -
PYFTQTSYTTEVEE DSC1_MOUSE 352 -1 -
PSFTETSYVTEVEE DSC1_HUMAN 352 -1 -
PEFEPQKYEAWVPE CAD3_MOUSE 318 -1 -
PYFTETSYTVEVEE DSC1_BOVIN 350 -1 -
PTFTRTSYVTSVEE DSC2_HUMAN 353 -1 -
PMFRDSQYSARIEE DSG3_HUMAN 265 -1 -

Motif 6 width=27
Element Seqn Id St Int Rpt
QEGIITVKKLLDFEKKRVYTLKVEASN CAD6_RAT 325 45 -
QEGIITVKKLLDFEKKKVYTLKVEASN CAD6_HUMAN 325 45 -
QEGIITVKKLLDFEKKKVYTLRWKASN CAD6_MOUSE 325 45 -
QDGVIRLRKPLDFETKKSYTLKVEAAN CAD8_MOUSE 333 45 -
QDGIIRLRKPLDFETKKSYTLKDEAAN CAD8_HUMAN 326 45 -
QEGIITVRKPLDYETRRLYTLKVEAEN CADA_CHICK 326 45 -
QEGVIKLKKPVDFETERAYSLKVEAAN CADB_HUMAN 325 45 -
QDGVVKLKKPVDFETKRAYSLKIEAAN CADB_MOUSE 325 45 -
NEGIIKPMKPLDYEYIQQYSFIVEATD CAD5_HUMAN 315 45 -
NDGLVTVVKPIDFETNRMFVLTVAAEN CAD2_MOUSE 440 46 -
NDGLVTVVKPIDFETNRMFVLTVAAEN CAD2_CHICK 445 46 -
NDGLVTVVKPIDFETNRMFVLTVAAEN CAD2_HUMAN 440 46 -
NDGILKTAKGLDFEAKQQYILHVRVEN CAD1_MOUSE 434 45 -
NDGLVTVVKPIDYETKSTYILTVVAEN CADO_XENLA 441 46 -
NDGILKTAKGLDFEAKQQYILHVAVTN CAD1_HUMAN 432 45 -
NDGLVTVVKPIDYETKSTYILTVVAEN CADN_XENLA 441 46 -
NEGMVTVVKAVDYEMNRAFMLTVMVSN CAD4_CHICK 447 46 -
NEGIIKPTKSLDYEVIQQYTFYIEATD CAD5_MOUSE 312 45 -
QEGVIKLKKPLDFETKKAYTFKVEASN CADC_HUMAN 326 45 -
NEGMVTVVKAVDYELNRAFMLTVMVSN CAD4_MOUSE 447 46 -
NQGILTTAKGLDFELRKQYVLQITVEN CADF_XENLA 448 45 -
NIGLLKTVKGLDYELKKQYILSVIVTN CAD1_XENLA 427 45 -
NNGILKTAKGLDYETKSRYDLVVTVEN CAD1_CHICK 439 46 -
NEGMLSVVKPLDYEISAFHTLLIKVEN CADD_CHICK 420 45 -
NQGILTTAKGLDFEVRKQYVIQITVEN CADB_XENLA 456 45 -
NQGILTTRKGLDFEAKNQHTLYVEVTN CAD3_HUMAN 386 46 -
NEGMLSVVKPLDYEISAFHTLLIKVEN CADD_HUMAN 420 45 -
NEGILCVIKPLDYEERQQVTLQIGVVN DSC2_MOUSE 413 46 -
NEGVLCVVKPLNYEVSRQVTLQIGVLN DSC1_MOUSE 412 46 -
NEGVLCVVKPLNYEVNRQVILQVGVIN DSC1_HUMAN 412 46 -
NQGVLTTKKGLDFEAQDQHTLYVEVTN CAD3_MOUSE 378 46 -
NEAVLCVVKPLNYEVNRQVVLQIGVLN DSC1_BOVIN 410 46 -
NEGVLCVVKPLNYEEKQQMILQIGVVN DSC2_HUMAN 413 46 -
NEGILKVVKALDYEQLQSVKLSIAVKN DSG3_HUMAN 325 46 -

Motif 7 width=18
Element Seqn Id St Int Rpt
SRVPLYIKVLDVNDNAPE CAD6_RAT 470 118 -
SRVPLYIKVLDVNDNAPE CAD6_HUMAN 470 118 -
SRVPLYIKVLDVNDNAPE CAD6_MOUSE 470 118 -
SRVPVAIKVLDVNDNAPE CAD8_MOUSE 478 118 -
SRVPVAIKVLDVNDNAPE CAD8_HUMAN 471 118 -
TRVPVYVRILDVNDNAPQ CADA_CHICK 471 118 -
AQVPVAIRVLDVNDNAPK CADB_HUMAN 470 118 -
TKVPVAIRVLDVNDNAPK CADB_MOUSE 470 118 -
SIVQVHIEVLDENDNAPE CAD5_HUMAN 461 119 -
GTGTLQIYLLDINDNAPQ CAD2_MOUSE 587 120 -
GTGTLQIYLLDINDNAPQ CAD2_CHICK 593 121 -
GTGTLQIYLLDINDNAPQ CAD2_HUMAN 587 120 -
GTGTLLLVLLDVNDNAPI CAD1_MOUSE 579 118 -
GTGTLQIYLLDINDNAPY CADO_XENLA 588 120 -
GTGTLLLILSDVNDNAPI CAD1_HUMAN 577 118 -
GTGTLQIYLLDINDNAPY CADN_XENLA 588 120 -
GTGTLQIYLIDINDNAPE CAD4_CHICK 594 120 -
SIVQVYIEVLDENDNPPE CAD5_MOUSE 459 120 -
SKVNILINVLDVNEFPPE CADC_HUMAN 471 118 -
GTGTLQIYLIDINDNAPQ CAD4_MOUSE 594 120 -
GTGTLILHVLDVNDNGPV CADF_XENLA 592 117 -
GTGTLVLNLLDVNDNGPF CAD1_XENLA 571 117 -
GTGTLLLLLQDVNDNGPT CAD1_CHICK 583 117 -
GTGTLHITLEDVNDNVPS CADD_CHICK 567 120 -
GTGTLILHVLDINDNGPV CADB_XENLA 600 117 -
GTGTLLLTLIDVNDHGPV CAD3_HUMAN 530 117 -
GTGTLLITLEDVNDNAPF CADD_HUMAN 567 120 -
CTGTLGIILEDVNDNGPF DSC2_MOUSE 559 119 -
CTGTLVVLLEDFNDHPPQ DSC1_MOUSE 559 120 -
CTGTLVVHLDDYNDHAPQ DSC1_HUMAN 559 120 -
GTGTLLLTLTDINDHGPI CAD3_MOUSE 522 117 -
CTGTLVVFLEDKNDHPPQ DSC1_BOVIN 558 121 -
CTGTLGIILQDVNDNSPF DSC2_HUMAN 559 119 -
STGTVYVRVPDFNDNCPT DSG3_HUMAN 477 125 -
Final Motifs
Motif 1  width=20
Element Seqn Id St Int Rpt
DLLEVNLQNGILFVNSRIDR Q9UN72 73 73 -
DLLEVNLQNGILFVNSRIDR O75288 73 73 -
DLLEVNLQNGILFVNSRIDR Q9Y5I3 73 73 -
DLLEVNLQNGILFVNSRIDR O75284 72 72 -
DLLEVNLQNGILFVNSRIDR Q9Y5H7 72 72 -
DLLEVNLQNGILFVNSRIDR O75279 73 73 -
DLLEVNLQNGILFVNSRIDR Q9Y5I1 73 73 -
DLLEVSLQNGILFVNSRIDR O75281 73 73 -
DLLEVSLQNGILFVNSRIDR Q9Y5H6 73 73 -
DLLEVNLQNGILFVNSRIDR O88689 73 73 -
DLLEVNLQNGILFVNSRIDR O75278 73 73 -
DLLEVNLQNGILFVNSRIDR Q9UN75 73 73 -
DLLEVNLQNGILFVNSRIDR O75283 73 73 -
DLLEVNLQNGILFVNSRIDR Q9UN73 73 73 -
DLLEVNLQNGILFVNSRIDR O75280 72 72 -
DLLEVNLQNGILFVNSRIDR Q9Y5I2 72 72 -
QLFSLNPRNGSLVTAGRIDR Q9Y5D1 73 73 -
QLFSLNPRNGSLVTAGRIDR Q9Y5G7 73 73 -
DLLEVNLQNGILFVNSRIDR O88690 73 73 -
QLFAVNPRSGSLITAGRIDR Q9Y5D8 74 74 -
QLFAVNPRSGSLITAGRIDR Q9Y5H2 74 74 -
QLFAVNPRSGSLITAGRIDR Q9Y5D9 74 74 -
DMFAIHPTSGVIVLTGRLDY FATH_HUMAN 193 193 -
QLFSLNPRSGTLVTAGRIDR Q9Y5C9 73 73 -
QLFSLNPRSGTLVTAGRIDR Q9Y5G4 73 73 -
QLFSLNPQSGSLVTAERIDR Q9Y5D4 73 73 -
QLFSLNPQSGSLVTAERIDR Q9Y5H0 73 73 -
QLFALNPRSGSLVTAGRIDR Q9Y5D2 73 73 -
QLFALNPRSGSLVTAGRIDR Q9Y5G8 73 73 -
DLFIINENTGDIQATKRLDR CAD6_RAT 99 99 -
QLFSLNPRSGSLITAGRIDR Q9Y5E0 77 77 -
QLFSLNPRSGSLITAGRIDR Q9Y5H3 77 77 -
DLFIINENTGDIQATKRLDR CAD6_HUMAN 99 99 -
QLFALNPRSGSLVTAGRIDR O60330 73 73 -
QLFALNPRSGSLVTAGRIDR Q9Y5D7 73 73 -
DLFIINENTGDIQATKRLDR Q90762 99 99 -
PLFALNPRSGSLITARRIDR Q9Y5D6 73 73 -
PLFALNPRSGSLITARRIDR Q9Y5H4 73 73 -
TIFQINDITGDIHAIKRLDR O54800 107 107 -
DLFIINEHTGDIQATKRLDR CAD6_MOUSE 99 99 -
QGLQLDLQTGQLILNEKLDR Q9Y5E8 73 73 -
QILLLSSLTGDLLLNEKLDR Q9Y5E2 73 73 -
TIFQINDVTGDIHAIKRLDR Q9ULB2 107 107 -
TIFQINDITGDIHAIKRLDR CAD8_MOUSE 107 107 -
ELLQLDIKTGNLLLYEKLDR Q9Y5E4 73 73 -
QLFALNQRSGSLVTAGRIDR Q9Y5D0 73 73 -
QLFALNQRSGSLVTAGRIDR Q9Y5G6 73 73 -
QHFQLSHQTGDLLLNEKLDR Q9Y5E6 73 73 -
QLFALNPRSGSLVTANRIDR Q9Y5D5 73 73 -
QLFALNPRSGSLVTANRIDR Q9Y5H1 73 73 -
TIFQINDVTGDIHAIKRLDR CAD8_HUMAN 100 100 -
PYFTVSAESGELLVSSRLDR Q9UN64 73 73 -
PYFTVSAESGELLVSSRLDR Q9UN71 73 73 -
EYFTVNPESGDLLVSDRIDR Q9UN65 73 73 -
EYFTVNPESGDLLVSDRIDR Q9Y5G2 73 73 -
QLFALNPRSGSLITAGRIDR O15039 73 73 -
QLFALNPRSGSLITAGRIDR Q9Y5G5 73 73 -
QYLLLDSHTGNLLTNEKLDR Q9NRJ8 73 73 -
QYLLLDSHTGNLLTNEKLDR Q9Y5E1 73 73 -
LHFSVDAESGDLLVKNRIDR Q9Y5C5 73 73 -
LHFSVDAESGDLLVKNRIDR Q9Y5F9 73 73 -
TLFIIDEKTGDIHATRRIDR CADA_CHICK 100 100 -
PYFTVSAESGELLVSSRLDR Q9Y5C6 73 73 -
PYFTVSAESGELLVSSRLDR Q9Y5G0 73 73 -
MHLQFDRQTGDLLLNEKLDR Q9Y5E7 75 75 -
DYFNVSLESGDLLVNGRIDR Q9Y5C8 70 70 -
DYFNVSLESGDLLVNGRIDR Q9Y5G3 70 70 -
ECLQLDTNTGDLLLREMLDR Q9Y5F1 73 73 -
QRLQLDRQTGDLLLREKLDR Q9Y5E5 72 72 -
TLFIIDEKTGDIHATRRIDR Q9Y6N8 100 100 -
QRLQLDINTGDLLLSETLDR Q9Y5F2 73 73 -
TIFVIDDKSGNIHATKTLDR Q15066 99 99 -
QLFALNPRSGTLVTAGRIDR Q9Y5D3 73 73 -
QLFALNPRSGTLVTAGRIDR Q9Y5G9 73 73 -
QHLQFDPQTHDLLLNEKLDR Q9Y5E3 72 72 -
KYLHLDLLTGNLLLNEKLDR Q9Y5E9 73 73 -
LHFSVDAQSGDLLVKDRIDR Q9UN63 73 73 -
LHFSVDAQSGDLLVKDRIDR Q9Y5F8 73 73 -
TIFVIDDKSGNIHATKTLDR CADB_HUMAN 99 99 -
TIFVIDDKSGNIHATKTLDR CADB_MOUSE 99 99 -
QYLLLDSHTGNLLTNEKLDR Q9UN67 73 73 -
IIFVIDDKSGNIHATKTLDR O93319 99 99 -
PYLDLNLETGVLYVNEKIDR Q9Z1B1 62 62 -
IVFTIDDTTGDIHAIQRLDR Q9Z0M3 105 105 -
ELLQLDAETGNLFLKEKLDR Q63418 73 73 -
TMFTIDETTGDIHAIQRLDR Q91838 98 98 -
TIFVIDDKSGNIHATKTLDR O93264 99 99 -
KVFRVDAETGDVFAIERLDR CAD5_HUMAN 91 91 -
SIFIIDENTGDIHATKRLDR Q90763 93 93 -
SIFIIDENTGDIHATKRLDR Q9ULB5 93 93 -
QLFALNPRSGSLVTAGRIDR Q9Z1B0 70 70 -
MHFRLHRKTGDLFVKEKLDR Q9Y5F3 73 73 -
QLFSHESAGRNLVTASRIDR O08963 73 73 -
KFFTVSPENGNLLVSDRIDR Q9Y5C7 73 73 -
KFFTVSPENGNLLVSDRIDR Q9Y5G1 73 73 -
LHLQLNQETADLLLNEKLDR Q9UN66 74 74 -
SLFVIDENTGDIHAAKKLDR Q9ULB4 99 99 -
GIFIINPISGQLSVTKPLDR CAD2_MOUSE 208 208 -
DLLEVNLQNGILFVNSRIDR O75286 73 73 -
GIFIINPISGQLSVTKPLDR Q9Z1Y3 208 208 -
LHLQLNQETADLLLNEKLDR Q9Y5F0 74 74 -
GIFIINPISGQLSVTKPLDR CAD2_CHICK 213 213 -
GIFIINPISGQLSVTKPLDR CAD2_HUMAN 208 208 -
GVFIIERETGWLKVTQPLDR CAD1_MOUSE 205 205 -
RHFRVDLDSGALLIKNPIDR Q9Y5C3 73 73 -
RHFRVDLDSGALLIKNPIDR Q9Y5F7 73 73 -
TIFLIDELTGDIHATERLDR Q63315 105 105 -
TIFLIDELTGDIHATERLDR Q63561 105 105 -
TIFLIDELTGDIHATERLDR Q9WTP5 105 105 -
GVFIINPISGQLSVTKPLDR CADO_XENLA 209 209 -
GVFIIERETGWLKVTEPLDR CAD1_HUMAN 203 203 -
GVFIIERETGWLKVTEPLDR Q15855 199 199 -
RFFEVNRETGEMFVNDRLDR O60622 75 75 -
RFFEVNRETGEMFVNDRLDR Q9UN70 75 75 -
RFFEVNRETGEMFVNDRLDR Q9Y5C4 75 75 -
TIFLIDELTGDIHAMERLDR Q9UJ99 108 108 -
GVFIINPIGGQLSVTKPLDR CADN_XENLA 209 209 -
GVFIIERETGWLKVTQPLDR Q9R0T4 207 207 -
HLLDVDADSGLLYTKQRIDR O14917 73 73 -
EVFSIDPVSGRMYVTRPMDR CAD4_CHICK 215 215 -
KIFGVDANTGNVLAYERLDR CAD5_MOUSE 88 88 -
KIFGVDANTGNVLAYERLDR O35542 89 89 -
KYFAVDAASGSLLVSERIDR O13129 76 76 -
GLFIIDPISGLLSVTKPLDR Q90275 84 84 -
RFFEVNRETGEMFVNDRLDR Q08192 75 75 -
TDLAIDRATGEIRTKVKLDR Q24292 68 68 -
GYFLIDAATGAVTTARSLDR O35161 309 309 -
RLLRLDETSGWLSVLHRIDR O60245 356 356 -
RLLRLDETSGWLSVLHRIDR O60246 356 356 -
RLLRLDETSGWLSVLHRIDR O60247 309 309 -
RLLRLDETSGWLSVLHRIDR O88185 356 356 -
TVFTIDETTGDIHAIRSLDR CADC_HUMAN 100 100 -
HFFSLDPITGVVTTAEELDR Q9R0M0 230 230 -
GVFIIERETGWLKVTEPLDR Q9UII7 203 203 -
RYLELDLTSGALFVNERIDR Q9Y5F4 88 88 -
RYLELDLTSGALFVNERIDR Q9Y5I4 88 88 -
ELFSIDPQSGLIRTAAALDR Q9NYQ7 374 374 -
GYFRIDSATGAVSTDSVLDR Q9NYQ6 294 294 -
EVFNIDSMSGRMYVTRPMDR CAD4_MOUSE 215 215 -
GVFRIEWETGWMLVTRPLDR CADF_XENLA 219 219 -
GVFAIGREDGWLNVTRPLDR CAD1_XENLA 197 197 -
RYFSLSLMSGALAVNQKIDR Q9Y5C2 73 73 -
RYFSLSLMSGALAVNQKIDR Q9Y5F6 73 73 -
ELFSIDPQSGLIRTAAALDR O88278 365 365 -
GIFIIERETGWLEVTEQLDR CAD1_CHICK 209 209 -
RLLRLDENSGWLSVLHRIDR O57537 328 328 -
AIFNIDPIFGRMNVTRPLDR P79883 224 224 -
LYFGVDLPSGNLVVREPADR Q9Y5F5 64 64 -
LYFGVDLPSGNLVVREPADR Q9Y5I5 64 64 -
DMFAIHPTSGVVVLTGRLDV Q9WU10 194 194 -
LPVQMNSEDGLLSTSSRLDR O55134 75 75 -
REFTLDPVTGEVKTNVVLDR FAT_DROME 101 101 -
GIFRINEISGDVSVTRPLDR CADD_CHICK 186 186 -
GIFRINEISGDVSVTRPLDR Q91353 186 186 -
GIFRIEKETGWMQVTRPLDR CADB_XENLA 227 227 -
QLFRVNPHNGVMYLQKEIDL Q9VEU1 312 312 -
DYFLLDAQTGELRTAKPLDR Q9VGG5 281 281 -
LPIQVDSEEGLLSTGRRLDR Q9NPG4 75 75 -
SLFKVDSRTGVVTTSASLDR Q9V5N8 405 405 -
RLLRLDRNTGLITVQGPVDR Q08174 294 294 -
GVFAVEKETGWLLLNKPLDR CAD3_HUMAN 156 156 -
SVFRIDPDRGELQIIGYLDR Q9VW71 815 815 -
DLFDINPHTGIVHTLTKLDR Q9VFH5 324 324 -
PVFSVDRETGVVRLRQELDR Q9VVG0 66 66 -
DLLEVNLQNGILFVNSRIDR Q9NRT8 82 82 -
GIFRINENTGSVSVTRTLDR CADD_HUMAN 186 186 -
NLFYVERDTGNLYCTGRVDR DSC2_MOUSE 184 184 -
SIIDMRQMDGLLTVGEVIDR O93508 63 63 -
NLFYIEKDTGDIYCTRSIDR DSC1_MOUSE 183 183 -
GTFRINENTGSVSVTRTLDR Q9WTR5 186 186 -
NLFYIEKDTGDIFCTRSIDR DSC1_HUMAN 183 183 -
NLFTLDTMSGEIRLAKSMDR Q19482 211 211 -
GVFTIEKESGWLLLHMPLDR CAD3_MOUSE 148 148 -
DLLEVNLQNGILFVNSRIDR Q9NRT7 73 73 -
RLFHLNATTGLITIKEPLDR Q9P2X5 298 298 -
GTFNIGPTSGIVKLAKELDF O15943 695 695 -
SKIKFDEQTLELSVSSPLDR Q9TWY4 64 64 -
SKIKFDEQTLELSVSSPLDR YOG7_CAEEL 64 64 -
DLLEVNLQNGILFVNSRIDR O75287 73 73 -
SLIGVRESDGQLSIMERIDR O93509 67 67 -
NLFFIEKDTGDIFCTRSIDR DSC1_BOVIN 181 181 -
TAFKLNARTGLITTTKLVDF O88277 404 404 -
HLFRLDPRSGRLTLAGQVDY Q9WVR2 295 295 -
RLFRLDPRSGRLTLAGPVDY O95206 295 295 -
NLFYVERDTGNLYCTRPVDR DSC2_HUMAN 184 184 -
VGFKLNARTGLITTTKLMDF Q9NYQ8 404 404 -
HNFSIDEDTGKIYVTRYLDA O01912 195 195 -
KWFRIDPSTGIIHLTRLLDF Q9XWM6 218 218 -
DNIFVIEREGLLYYNRALDR Q12864 67 67 -
DLLEVNLQNGILFVNSRIDR Q9NRU2 72 72 -
GIFVVDKNTGDINITAIVDR DSG3_HUMAN 98 98 -
DGIFKIEKDGLLYHTRALDR Q9R100 66 66 -
DGIFKIEKDGLLYHTRVLDR CADL_RAT 66 66 -
SVISIDAKTGIVKLLKSLDR Q19319 782 782 -
DYFQIDESTGVLKQTKAVDT Q9VAF5 184 184 -
DLLEVNLQNGILFVNSRIDR Q9Y5H9 73 73 -
GLLEVNLQNGILFVNSRIDR Q9UN74 73 73 -
TIFIIDDTTGDIHSTKSLDR CADE_HUMAN 99 99 -
DLLEVNLQNGILFVNSRIDR O15053 73 73 -
GLLEVNLQNGILFVNSRIDR O75285 73 73 -
DLLEVNLQNGILFVNSRIDR Q9Y5H5 73 73 -
DLLEVNLQNGILFVNSRIDR O75282 73 73 -
DLLEVNLQNGILFVNSRIDR Q9Y5I0 73 73 -
DLLEVNLQNGILFVNSRIDR O75277 73 73 -
DLLEVNLQNGILFVNSRIDR Q9Y5H8 73 73 -

Motif 2 width=30
Element Seqn Id St Int Rpt
FEHRVTIFTVPENCRSGTSVGKVTATDLDE DSC1_HUMAN 242 39 -
FTQTAYKAAFDENVPIGTTIMSLSAVDPDE FATH_HUMAN 463 250 -
FTDGPYIVTVPEMSDMGTSVLQVTATDADD CADE_HUMAN 159 40 -
FERTIYKVRLLENAPNGTLVVTVNATDLDE O75286 242 149 -
FERTIYKVRLLENAPNGTLVVTVNATDLDE Q9Y5H8 242 149 -
FYQSVYKVTVLENAFNGTLVIKLNATDPDD O75277 242 149 -
FYQSVYKVTVLENAFNGTLVIKLNATDPDD Q9Y5I0 242 149 -
FDRTIYKVRLLENVPNGTLVIKLNASDLDE O75285 242 149 -
FDRTIYKVRLLENVPNGTLVIKLNASDLDE Q9UN74 242 149 -
FAQSVYKVKLLENTANGTLVVKLNASDADE O75287 242 149 -
FAQSVYKVKLLENTANGTLVVKLNASDADE Q9Y5H9 242 149 -
FDRTLYTVKLPENVSIGTLVIHPNASDLDE O15053 242 149 -
FDRTLYTVKLPENVSIGTLVIHPNASDLDE Q9Y5H5 242 149 -
FDRTLYTVKLPENVSIGTLVIHPNASDLDE O75282 242 149 -
FDRTLYTVKLPENVSIGTLVIHPNASDLDE Q9UN72 242 149 -
FDQAVYRVHLLETTANGTLVTTLNASDADE O75288 242 149 -
FDQAVYRVHLLETTANGTLVTTLNASDADE Q9Y5I3 242 149 -
FDKSIYNVRLLENAPSGTLVIKLNASDADE O75284 241 149 -
FDKSIYNVRLLENAPSGTLVIKLNASDADE Q9Y5H7 241 149 -
FDKSEYKVSLMENAAKETLVLKLNATDRDE O75279 242 149 -
FDKSEYKVSLMENAAKETLVLKLNATDRDE Q9Y5I1 242 149 -
FEQSEYEVRIFENADNGTTVIKLNASDPDE O75281 242 149 -
FEQSEYEVRIFENADNGTTVIKLNASDPDE Q9Y5H6 242 149 -
FDRSLYTVKLPENVPNGTLVVKVNASDLDE O88689 242 149 -
FDKPSYKVVLSENVQNDTRVIQLNASDPDE O75278 242 149 -
FDKPSYKVVLSENVQNDTRVIQLNASDPDE Q9UN75 242 149 -
FEQSEYEVRIFENADNGTTVIRLNASDRDE O75283 242 149 -
FEQSEYEVRIFENADNGTTVIRLNASDRDE Q9UN73 242 149 -
FDRPVYEVKMYENQVNQTLVIRLNASDSDE O75280 241 149 -
FDRPVYEVKMYENQVNQTLVIRLNASDSDE Q9Y5I2 241 149 -
FTQPVYRVSVPENLPVGTPVLAVTATDQDE Q9Y5D1 242 149 -
FTQPVYRVSVPENLPVGTPVLAVTATDQDE Q9Y5G7 242 149 -
FQHPEYEVRILENSDNGTTVIRLNASDKDE O88690 242 149 -
FTQSVYRVSVPENISSGTRVLMVNATDPDE Q9Y5D8 243 149 -
FTQSVYRVSVPENISSGTRVLMVNATDPDE Q9Y5H2 243 149 -
FTQSVYRVSVPENISSGTRVLMVNATDPDE Q9Y5D9 243 149 -
FAQRIYRVKVLENVPPGTWLLTATASDLDE Q9Y5C9 242 149 -
FAQRIYRVKVLENVPPGTWLLTATASDLDE Q9Y5G4 242 149 -
FTQPEYRVSVWENVPVGTRLLTVNATDPDE Q9Y5D4 242 149 -
FTQPEYRVSVWENVPVGTRLLTVNATDPDE Q9Y5H0 242 149 -
FTPSEYSVSVPENIPVGTRLLMLTATDPDE Q9Y5D2 242 149 -
FTPSEYSVSVPENIPVGTRLLMLTATDPDE Q9Y5G8 242 149 -
FTKDVYTATVPEMADVGTFVVQVTATDADD CAD6_RAT 159 40 -
FTLPEYRVSVPENLPVGTQLLTVTATDRDE Q9Y5E0 246 149 -
FTLPEYRVSVPENLPVGTQLLTVTATDRDE Q9Y5H3 246 149 -
FTKEVYTATVPEMSDVGTFVVQVTATDADD CAD6_HUMAN 159 40 -
FAQPEYRASVPENLALGTQLLVVNATDPDE O60330 242 149 -
FAQPEYRASVPENLALGTQLLVVNATDPDE Q9Y5D7 242 149 -
FTKDVYNASIPEMSDVGTFVVQVTATDADD Q90762 159 40 -
FTQAQYHINVPENVPLGTQLLMVNATDPDE Q9Y5D6 242 149 -
FTQAQYHINVPENVPLGTQLLMVNATDPDE Q9Y5H4 242 149 -
FLNGPYHATVPEMSILGTSVTNVTATDADD O54800 167 40 -
FTKDVYTATVPEMADVGTFVVQVTATDADD CAD6_MOUSE 159 40 -
FVQALYEVQVPENSPVGSLVVKVSARDLDT Q9Y5E8 242 149 -
FVRSLYKVQVPENSPVGSMVVSVSARDLDT Q9Y5E2 242 149 -
FLNGPYHATVPEMSILGTSVTNVTATDADD Q9ULB2 167 40 -
FLNGPYHATVPEMSILGTSVTNVTATDADD CAD8_MOUSE 167 40 -
FLQSFYEVQVPENSPLNSLVVVVSARDLDA Q9Y5E4 242 149 -
FSLPQYQVTVPENVPVGTRLLTVHAIDLDE Q9Y5D0 242 149 -
FSLPQYQVTVPENVPVGTRLLTVHAIDLDE Q9Y5G6 242 149 -
FAQPLYEVAVLENTPVNSVIVTVSASDLDT Q9Y5E6 242 149 -
FTQPEYRISIPENTLVGTRILTVTATDADE Q9Y5D5 242 149 -
FTQPEYRISIPENTLVGTRILTVTATDADE Q9Y5H1 242 149 -
FLNGPYHATVPEMSILGTSVTNVTATDADD CAD8_HUMAN 160 40 -
FSQDVYRVSLSENVYPGTTVLQVTATDQDE Q9UN64 242 149 -
FSQDVYRVSLSENVYPGTTVLQVTATDQDE Q9UN71 242 149 -
FSQDVYRVTLREDVPPGFFVLQVTATDRDE Q9UN65 242 149 -
FSQDVYRVTLREDVPPGFFVLQVTATDRDE Q9Y5G2 242 149 -
FPHPIYRVKVLENMPPGTRLLTVTASDPDE O15039 242 149 -
FPHPIYRVKVLENMPPGTRLLTVTASDPDE Q9Y5G5 242 149 -
FAQALYETQAPENSPVGSLIVKVSAGDADS Q9NRJ8 242 149 -
FAQALYETQAPENSPVGSLIVKVSAGDADS Q9Y5E1 242 149 -
FSRDEYRISLSENLPPGSPVLQVTATDQDE Q9Y5C5 242 149 -
FSRDEYRISLSENLPPGSPVLQVTATDQDE Q9Y5F9 242 149 -
FPEEIYTASVPEMSVVGTSVVQVTATDADD CADA_CHICK 160 40 -
FNRDVYRVSLRENVPPGTTVLQVSATDQDE Q9Y5C6 242 149 -
FNRDVYRVSLRENVPPGTTVLQVSATDQDE Q9Y5G0 242 149 -
FAKLLYEVQIPEDSPVGSQVAIVSARDLDI Q9Y5E7 244 149 -
FSQEVYRVSLQENVPWGTSVLRVMATDQDE Q9Y5C8 239 149 -
FSQEVYRVSLQENVPWGTSVLRVMATDQDE Q9Y5G3 239 149 -
FEQAFYEVKILENSILGSLVVTVSAWDLDS Q9Y5F1 242 149 -
FVHTPYGVQVLENSPLDSPIVRVLARDIDA Q9Y5E5 241 149 -
FPEEIYTASVPEMSVVGTSVVQVTATDADD Q9Y6N8 160 40 -
FEQAFYEVKIRENSILGSLILIVSAWDLDS Q9Y5F2 242 149 -
FLHETYHANVPERSNVGTSVIQVTASDADD Q15066 159 40 -
FTQPEYHVSVRENVPVGTRLLTVKATDPDE Q9Y5D3 242 149 -
FTQPEYHVSVRENVPVGTRLLTVKATDPDE Q9Y5G9 242 149 -
FAQELYEAQVPENNPLGSLVITVSARDLDA Q9Y5E3 241 149 -
FPQSLYEVQVPEDRPLGSWIATISAKDLDA Q9Y5E9 242 149 -
FSQDVYRVSLREDVPPGTSILRVKATDQDE Q9UN63 242 149 -
FSQDVYRVSLREDVPPGTSILRVKATDQDE Q9Y5F8 242 149 -
FLHETYHANVPERSNVGTSVIQVTASDADD CADB_HUMAN 159 40 -
FLHEIYHANVPERSNVGTSVIQVTASDADD CADB_MOUSE 159 40 -
FAQALYETQAPENSPIGFLIVKVWAEDVDS Q9UN67 242 149 -
FLHENYHANVPERSNVGTSVIQVTASDADD O93319 159 40 -
FDQPVYTVSLPENSPPGTLVIQLNATDPDE Q9Z1B1 250 168 -
FLDGPYIATVPEMSPVGTSVIQVTATDADD Q9Z0M3 165 40 -
FVQSLYKVQVPENNPLNAFVVTVSATDLDA Q63418 242 149 -
FLDGPYTASVPEMSPVGTSIIQVSATDADD Q91838 158 40 -
FLHENYHANVPEMSNVGTSVIQVTASDADD O93264 159 40 -
FTHRLFNASVPESSAVGTSVISVTAVDADD CAD5_HUMAN 151 40 -
FLDGPYTAGVPEMSPVGTSVVQVTATDADD Q90763 153 40 -
FLDGPYTAGVPEMSPVGTSVVQVTATDADD Q9ULB5 153 40 -
FRESELEIKMSENAAAGMRFPLPHAWDPDI Q9Z1B0 130 40 -
FSRLVYRAQVSENSPNGSLVATVTAVDLDE Q9Y5F3 242 149 -
FDQPVYRVKVLENVTPGTLLLTVRASDPDE O08963 239 146 -
FTQDMYRVNVAENLPAGSSVLKVMAIDMDE Q9Y5C7 242 149 -
FTQDMYRVNVAENLPAGSSVLKVMAIDMDE Q9Y5G1 242 149 -
FQQPFYRVQISEDSPISFLVVKVSATDVDT Q9UN66 243 149 -
FTKDLYTASVPEMSGVGTSVIQVTATDADD Q9ULB4 159 40 -
FLHQVWNGSVPEGSKPGTYVMTVTAIDADD CAD2_MOUSE 267 39 -
FLHQVWNGSVPEGSKPGTYVMTVTAIDADD Q9Z1Y3 267 39 -
FEQPFYRVQISEDSPVGFLVVKVSATDVDT Q9Y5F0 243 149 -
FLHQVWNGTVPEGSKPGTYVMTVTAIDADD CAD2_CHICK 272 39 -
FLHQVWNGTVPEGSKPGTYVMTVTAIDADD CAD2_HUMAN 267 39 -
FTQEVFEGSVAEGAVPGTSVMKVSATDADD CAD1_MOUSE 264 39 -
FQQSSYRISVLESAPAGMVLIQLNASDPDL Q9Y5C3 242 149 -
FQQSSYRISVLESAPAGMVLIQLNASDPDL Q9Y5F7 242 149 -
FLHGPYIGSVAELSPTGTSVMQVMASDADD Q63315 165 40 -
FLHGPYIGSVAELSPTGTSVMQVMASDADD Q63561 165 40 -
FLHGPYIGSVAELSPTGTSVMQVMASDADD Q9WTP5 165 40 -
FLHQIWNGTIPEGSKPGTYVMTVTAIDGDD CADO_XENLA 268 39 -
FTQEVFKGSVMEGALPGTSVMEVTATDADD CAD1_HUMAN 262 39 -
FTQEVFKGSVMEGALPGTSVMEVTATDADD Q15855 258 39 -
FNQSLYRARVLEDAPSGTRVVQVLATDLDE O60622 244 149 -
FNQSLYRARVLEDAPSGTRVVQVLATDLDE Q9UN70 244 149 -
FNQSLYRARVLEDAPSGTRVVQVLATDLDE Q9Y5C4 244 149 -
FLHGPYIGSVAELSPTGTSVMQVMASDADD Q9UJ99 168 40 -
FLHQIWNGSIPEGSKPGTYVMTVTAIDGDD CADN_XENLA 268 39 -
FIQEVFEGSVAEGALPGTSVMQVSATDADD Q9R0T4 266 39 -
FEAPSYLVELPENTPLGTVVIDLNATDADE O14917 243 150 -
FINQVYNGSVDEGSKPGTYVMTVTANDADD CAD4_CHICK 274 39 -
FSHQVFNASVPEMSAIGTSVIRVTAVDADD CAD5_MOUSE 148 40 -
FSHQVFNASVPEMSAIGTSVIRVTAVDADD O35542 149 40 -
FNQSTYKASVRENTPSGTLVTKVSAYDLDD O13129 244 148 -
FTHQIWNGTVDEGAKPGTFVMTVTSQDKDD Q90275 143 39 -
FNQSLYRARVPGGCTSGTRVVQVLATDLDE Q08192 244 149 -
FNQSRYFATVPENATVGTSVLQVYASDTDA Q24292 233 145 -
FEQSEYRERIRENLEVGYEVLTIRATDGDA O35161 368 39 -
FGQSVVEVYFPENNIPGERVATVLATDADS O60245 535 159 -
FGQSVVEVYFPENNIPGERVATVLATDADS O60246 535 159 -
FGQSVVEVYFPENNIPGERVATVLATDADS O60247 488 159 -
FGQSVVEVYFPENNIPGERVATVLATDADS O88185 535 159 -
FLDGPYVATVPEMSPVGAYVLQVKATDADD CADC_HUMAN 160 40 -
FEQQEYKESLRENLEVGYEVLTVRATDGDA Q9R0M0 289 39 -
FTQEVFKGSVMEGALPGTSVMEVTATDADD Q9UII7 262 39 -
FDQSTYRVQLREDSPPGTLVVKLNASDPDE Q9Y5F4 257 149 -
FDQSTYRVQLREDSPPGTLVVKLNASDPDE Q9Y5I4 257 149 -
FEQAQYRETLRENVEEGYPILQLRATDGDA Q9NYQ7 433 39 -
FEQSEYRERVRENLEVGYEVLTIRASDRDS Q9NYQ6 353 39 -
FINQVYNGSVDEGSKPGTYVMTVTANDADD CAD4_MOUSE 274 39 -
FTQDVFRGSVREGVQPGTQVMAVSATDEDD CADF_XENLA 278 39 -
FTQSVFEGSVPEGSKPGTAVMTVSATDADD CAD1_XENLA 256 39 -
FQSSVLRVGIPENAPIGTLLLRLNATDPDE Q9Y5C2 242 149 -
FQSSVLRVGIPENAPIGTLLLRLNATDPDE Q9Y5F6 242 149 -
FEQAQYRETLRENVEEGYPILQLRATDGDA O88278 424 39 -
FIKEVFVGYIEENAKPGTSVMTVNATDADD CAD1_CHICK 268 39 -
FSQAAVEVAFPENNVLGERVATVLATDADS O57537 507 159 -
FSSPIFNGSVDEASKPGTYVMTVTAHDADD P79883 283 39 -
FERSVYRTKVPETAPNGTVLFRVQALDPDE Q9Y5F5 233 149 -
FERSVYRTKVPETAPNGTVLFRVQALDPDE Q9Y5I5 233 149 -
FTQTSYKASFDENAPVGTPVMRVSAVDPDE Q9WU10 464 250 -
FAESSLALEIPEDTVPGTLLINLTATDPDQ O55134 244 149 -
FDHSDYNVSLNETALPGTPVVTVMASDNDL FAT_DROME 270 149 -
FKEGPYVGHVMEGSPTGTTVMRMTAFDADD CADD_CHICK 245 39 -
FKEGPYVGHVMEGSPTGTTVMRMTAFDADD Q91353 245 39 -
FTQPVFRGSVREGVQPGTKVMSVSATDDDD CADB_XENLA 286 39 -
FEADYYNISIVENLPTGFSVLQVNAVDRDQ Q9VEU1 375 43 -
FEQQSYSAVVEENSEIGTSVERVHATDLDT Q9VGG5 766 465 -
FAESSLALEIQEDAAPGTLLIKLTATDPDQ Q9NPG4 244 149 -
FEAEQFEASIREGATVGSTVITLRATDQDI Q9V5N8 464 39 -
FTQSVTEVAFPENNKPGEVIAEITASDADS Q08174 472 158 -
FTQDTFRGSVLEGVLPGTSVMQVTATDEDD CAD3_HUMAN 215 39 -
IQKTLATFRLTESARIGTVVHCLHATDADS Q9VW71 874 39 -
FSQTIYNASVLENSEQDTIITHVQAVDVDS Q9VFH5 510 166 -
FTNAPYSATVPENTPAGVSILTVKAVDGDV Q9VVG0 245 159 -
FPVEEQRVLIYESRLPDSVFPLEGASDADV Q9NRT8 142 40 -
FREGPYIGHVMEGSPTGTTVMRMTAFDADD CADD_HUMAN 245 39 -
FTQKLYSFTVQENSRIGSIVGEVCATDLDE DSC2_MOUSE 243 39 -
FEHSSLKVELSEDSPIGSRVLKVHAFDPDA O93508 234 151 -
FETKLTVFSVPENCRSGTSVGQVTAIDKDE DSC1_MOUSE 242 39 -
FREGPYIGHVMEGSPTGTTVMRMTAFDADD Q9WTR5 245 39 -
FEKDSYFGEIREDAPIGTTVLSVFARDLDS Q19482 270 39 -
FTQDTFRGSVLEGVMPGTSVMQVTATDEDD CAD3_MOUSE 207 39 -
FRGREQIIFIPESRLLNSRFPIEGAADADI Q9NRT7 133 40 -
FTQSFVTVSIPENNSPGIQLTKVSAMDADS Q9P2X5 466 148 -
FSQQVYTPNVDENAGPNTLVTTVVASDKDG O15943 858 143 -
FPIDVQRVEIPETAPIGWRVQISGATDPDE Q9TWY4 117 33 -
FPIDVQRVEIPETAPIGWRVQISGATDPDE YOG7_CAEEL 117 33 -
FERSTIAVDLVEDAPLGYLLLELHATDDDE O93509 238 151 -
FENKLTVFTVPENCRTGTSVGKVTAIDLDE DSC1_BOVIN 240 39 -
FNRSSYEGTLDENIPPGTSVLTVTATDQDH O88277 458 34 -
TQETGVTSLVPEGAARESLVALVSTSDRDS Q9WVR2 392 77 -
TPEAGATSLVPEGAARESLVALVSTSDRDS O95206 392 77 -
FTEETYTFTIFENCRVGTTVGQVCATDKDE DSC2_HUMAN 243 39 -
FNRSSYDGTLDENIPPGTSVLAVTATDRDH Q9NYQ8 458 34 -
FSSSLVEISIREDLKLHEPFYVVQASDKDK O01912 252 37 -
FTRPLYTAQVREDIPLNQTILKVTAVDKDT Q9XWM6 277 39 -
FLQSKYEGSVRQNSRPGKPFLYVNATDLDD Q12864 126 39 -
FSVTEQKLSIPESRLLDSRFPLEGASDADV Q9NRU2 132 40 -
FSQQIFMGEIEENSASNSLVMILNATDADE DSG3_HUMAN 157 39 -
FLQSKYEGSVRQNSRPGKPFMYVNATDLDD Q9R100 125 39 -
FLQTKYEGSVRQNSRPGKPFMYVNATDLDD CADL_RAT 125 39 -
AKKPMYIASVAENSPANVVIVKVEATDADD Q19319 1061 259 -
FQKPIYEVQVSEGAEINSTVTVVHAEDPEN Q9VAF5 461 257 -

Motif 3 width=13
Element Seqn Id St Int Rpt
AYELVVTARDGGS Q9Y5I0 420 148 -
AYELVVTARDGGS O75285 420 148 -
AYELVVTARDGGS Q9UN74 420 148 -
AYELVVTARDGGS O75287 420 148 -
AYELVVTARDGGS Q9Y5H9 420 148 -
AYELVVTARDGGS O15053 420 148 -
AYELVVTARDGGS Q9Y5H5 420 148 -
AYELVVTARDGGS O75282 420 148 -
AYELVVTARDGGS Q9UN72 420 148 -
VYELVVTARDGGS O75288 420 148 -
VYELVVTARDGGS Q9Y5I3 420 148 -
VYELVVTARDGGS O75284 419 148 -
VYELVVTARDGGS Q9Y5H7 419 148 -
AYELVVTARDGGS O75279 419 147 -
AYELVVTARDGGS Q9Y5I1 419 147 -
AYELVVTARDGGS O75281 420 148 -
AYELVVTARDGGS Q9Y5H6 420 148 -
DYKVVVTARDGGS O88689 420 148 -
AYELVVTARDGGS O75278 420 148 -
AYELVVTARDGGS Q9UN75 420 148 -
AYELVVTARDGGS O75283 420 148 -
AYELVVTARDGGS Q9UN73 420 148 -
AYELVVTARDGGS O75280 419 148 -
AYELVVTARDGGS Q9Y5I2 419 148 -
FYELGVEARDGPG Q9Y5D1 314 42 -
FYELGVEARDGPG Q9Y5G7 314 42 -
DYQVVVTARDGGS O88690 420 148 -
FYEMEIQGQDGGG Q9Y5D8 315 42 -
FYEMEIQGQDGGG Q9Y5H2 315 42 -
FYEMEIQGQDGGG Q9Y5D9 315 42 -
FYEMEIQAEDGGG Q9Y5C9 314 42 -
FYEMEIQAEDGGG Q9Y5G4 314 42 -
FYEIKIEAQDGPG Q9Y5D4 314 42 -
FYEIKIEAQDGPG Q9Y5H0 314 42 -
FYLMEVVAQDGGA Q9Y5D2 314 42 -
FYLMEVVAQDGGA Q9Y5G8 314 42 -
QYQVVIQAKDMGG CAD6_RAT 231 42 -
FYEIEIQAEDGGA Q9Y5E0 318 42 -
FYEIEIQAEDGGA Q9Y5H3 318 42 -
QYQVVIQAKDMGG CAD6_HUMAN 231 42 -
FYQMEVQAMDNAG O60330 314 42 -
FYQMEVQAMDNAG Q9Y5D7 314 42 -
QYQVVIQAKDMGG Q90762 231 42 -
MYSMEVQAQDGAG Q9Y5D6 314 42 -
MYSMEVQAQDGAG Q9Y5H4 314 42 -
EYLVVIQAKDMGG O54800 239 42 -
QYQVVIQAKDMGG CAD6_MOUSE 231 42 -
SYDLDIEASDGGG Q9Y5E8 314 42 -
TYTLTIQAKDGGG Q9Y5E2 314 42 -
EYLVVIQAKDMGG Q9ULB2 239 42 -
EYLVVIQAIDMGG CAD8_MOUSE 239 42 -
YYNVEIVATDGGG Q9Y5E4 313 41 -
FYEMEVQAQDGPG Q9Y5D0 314 42 -
FYEMEVQAQDGPG Q9Y5G6 314 42 -
SYEVDIEAKDGGG Q9Y5E6 314 42 -
FYNITLTAKDGGN Q9Y5D5 417 145 -
FYNITLTAKDGGN Q9Y5H1 417 145 -
EYLVVIQAKDMGG CAD8_HUMAN 232 42 -
EYSIVLEARDGGG Q9UN64 312 40 -
EYSIVLEARDGGG Q9UN71 312 40 -
EYNLTITATDGGK Q9UN65 417 145 -
EYNLTITATDGGK Q9Y5G2 417 145 -
FYEMEIQAEDVGA O15039 314 42 -
FYEMEIQAEDVGA Q9Y5G5 314 42 -
SYKINIQAMDGGG Q9NRJ8 314 42 -
SYKINIQAMDGGG Q9Y5E1 314 42 -
RYTMEVEAKDGGG Q9Y5C5 314 42 -
RYTMEVEAKDGGG Q9Y5F9 314 42 -
QYQVVIQAKDMGG CADA_CHICK 232 42 -
EYSMVVEGRDGGG Q9Y5C6 310 38 -
EYSMVVEGRDGGG Q9Y5G0 310 38 -
TYTVNIQATDGGG Q9Y5E7 316 42 -
RYVLSVEAKDGGV Q9Y5C8 310 41 -
RYVLSVEAKDGGV Q9Y5G3 310 41 -
SYSIIIQATDGGG Q9Y5F1 314 42 -
SYHVEIEATDGGG Q9Y5E5 313 42 -
QYQVVIQAKDMGG Q9Y6N8 232 42 -
SYSIIIQATDGGG Q9Y5F2 314 42 -
EYHVVIQAKDMGG Q15066 231 42 -
EYNITVTATDQGT Q9Y5D3 417 145 -
EYNITVTATDQGT Q9Y5G9 417 145 -
SYDVDVEATDGGG Q9Y5E3 312 41 -
SYTINIQATDGGG Q9Y5E9 314 42 -
RYTINIEAKDRGS Q9UN63 314 42 -
RYTINIEAKDRGS Q9Y5F8 314 42 -
EYHVVIQAKDMGG CADB_HUMAN 231 42 -
EYHVVIQAKDMGG CADB_MOUSE 231 42 -
SYKINIQAMDGGG Q9UN67 314 42 -
EYHVVIQAKDMGG O93319 231 42 -
SYTLTVVARDRGE Q9Z1B1 428 148 -
YYEVIIQAKDMGG Q9Z0M3 237 42 -
NHNIEIAATDGGG Q63418 313 41 -
YYEVIIQAKDMGG Q91838 230 42 -
EYHVVIQAKDMGG O93264 231 42 -
RYEIVVEARDAQG CAD5_HUMAN 222 41 -
QYLLVIQAKDMVG Q90763 225 42 -
QYLLVIQAKDMVG Q9ULB5 225 42 -
FYEMEVQATDNAG Q9Z1B0 310 150 -
TYDIDIQATDGGG Q9Y5F3 314 42 -
LYEMEIQAEDVGA O08963 311 42 -
EYNVTITATDKGN Q9Y5C7 417 145 -
EYNVTITATDKGN Q9Y5G1 417 145 -
SYEVNIEARDAGG Q9UN66 315 42 -
QYQVVIQAKDMGG Q9ULB4 231 42 -
QYTLIIQATDMEG CAD2_MOUSE 344 47 -
QYTLIIQATDMEG Q9Z1Y3 344 47 -
SYEVNIEARDAGT Q9Y5F0 315 42 -
QYTLIIQATDMEG CAD2_CHICK 349 47 -
QYTLIIQATDMEG CAD2_HUMAN 344 47 -
TYTLVVQAADLQG CAD1_MOUSE 342 48 -
YYEFDVRARDGGS Q9Y5C3 315 43 -
YYEFDVRARDGGS Q9Y5F7 315 43 -
RYEVVIQATDMAG Q63315 237 42 -
RYEVVIQATDMAG Q63561 237 42 -
RYEVVIQATDMAG Q9WTP5 237 42 -
RYTLIIQATDMEG CADO_XENLA 345 47 -
TYTLVVQAADLQG CAD1_HUMAN 340 48 -
TYTLVVQAADLQG Q15855 336 48 -
EYNLSITARDAGT O60622 422 148 -
EYNLSITARDAGT Q9UN70 422 148 -
EYNLSITARDAGT Q9Y5C4 422 148 -
RYEVVIQATDMAG Q9UJ99 240 42 -
RYTLIIQATDMEG CADN_XENLA 345 47 -
TYTLVVQAADLQG Q9R0T4 344 48 -
EYNVTIVARDGGS O14917 437 164 -
QYMVIVQATDMEG CAD4_CHICK 351 47 -
EYKIVVETQDALG CAD5_MOUSE 219 41 -
EYKIVVETQDALG O35542 220 41 -
EYNITVTARDSGL O13129 422 148 -
QYTLIIQATDMEG Q90275 220 47 -
EYNLSITARDAGT Q08192 421 147 -
NYTLSVVATDKGT Q24292 416 153 -
EYQLLVEANDQGR O35161 437 39 -
RYEFKVNAKDKGI O60245 604 39 -
RYEFKVNAKDKGI O60246 604 39 -
RYEFKVNAKDKGI O60247 557 39 -
RYEFKVNAKDKGI O88185 604 39 -
QYQVLIQAKDMGG CADC_HUMAN 232 42 -
EYTLRIRAQDGGR Q9R0M0 469 150 -
TYTLVVQAADLQG Q9UII7 340 48 -
VYNITVTATDGGI Q9Y5F4 434 147 -
VYNITVTATDGGI Q9Y5I4 434 147 -
SYELVVEASDQGQ Q9NYQ7 508 45 -
EYQLLVEANDQGR Q9NYQ6 422 39 -
QYTVIVQATDMEG CAD4_MOUSE 351 47 -
EYTLTVQATDLEG CADF_XENLA 356 48 -
VYTLTIQAADGEF CAD1_XENLA 334 48 -
FYEIHARARDQGQ Q9Y5C2 315 43 -
FYEIHARARDQGQ Q9Y5F6 315 43 -
SYELVVEASDQGQ O88278 499 45 -
NYTLIVQATDQEG CAD1_CHICK 346 48 -
RYEFRVVAKDKGI O57537 576 39 -
QYTVVIQATDMEG P79883 360 47 -
EYQVLITASDSGS Q9Y5F5 410 147 -
EYQVLITASDSGS Q9Y5I5 410 147 -
VYTLRIRASDWGL Q9WU10 534 40 -
AYEVDVQARDLGP O55134 317 43 -
KYNLTVVAMDQGT FAT_DROME 459 159 -
KYELVIEAKDMGG CADD_CHICK 326 51 -
KYELVIEAKDMGG Q91353 326 51 -
EYTLTVQAADLDG CADB_XENLA 364 48 -
LYNLKIIAADTGG Q9VEU1 1018 613 -
TYQLQIQASDQGT Q9VGG5 835 39 -
AYEVDVQARDLGP Q9NPG4 317 43 -
SYRLVIRAQDGGS Q9V5N8 654 160 -
SYELKVVAADRGS Q08174 543 41 -
EYTLTIQATDMDG CAD3_HUMAN 293 48 -
NYALHITAKDGGS Q9VW71 942 38 -
EIDLLVRARDSGI Q9VFH5 711 171 -
SYSLTVVAIDGGQ Q9VVG0 552 277 -
AHNLFLTATDGGK Q9NRT8 216 44 -
KYELIIEAQDMAG CADD_HUMAN 326 51 -
KYQLLIKVQDMDG DSC2_MOUSE 318 45 -
SYELHIQASDLGA O93508 307 43 -
TYKLVMEVRDMGG DSC1_MOUSE 317 45 -
KYELIIEAQDMAG Q9WTR5 326 51 -
TYQLIMEVRDMGG DSC1_HUMAN 317 45 -
RYSLKVTARDMGT Q19482 546 246 -
EYRLTVQATDMDG CAD3_MOUSE 285 48 -
ELHLLLTATDGGK Q9NRT7 207 44 -
KYLFTILAKDNGV Q9P2X5 535 39 -
KYELNVTAMDDGS O15943 926 38 -
SYTFEYEAKDLGT Q9TWY4 701 554 -
SYTFEYEAKDLGT YOG7_CAEEL 703 556 -
TYEFEVQAQDLGP O93509 311 43 -
TYKLIMEVRDMGG DSC1_BOVIN 315 45 -
IYSLKITASDGKN O88277 635 147 -
EYNLTLVAEDRGA Q9WVR2 462 40 -
EYNLTLVAEDRGA O95206 462 40 -
KYQLKIKVQDMDG DSC2_HUMAN 318 45 -
SYSLKITASDGKN Q9NYQ8 635 147 -
NYKLRVKATDLGI O01912 322 40 -
VYRFNVTARDHGE Q9XWM6 346 39 -
SYNLVISVKDMGG Q12864 206 50 -
QLKLLLTATDGGK Q9NRU2 206 44 -
SYRLVVSGADKDG DSG3_HUMAN 232 45 -
SYNLVVSVKDMGG Q9R100 205 50 -
YYNLVVSVKDMGG CADL_RAT 205 50 -
SYALTVQATDHGT Q19319 1234 143 -
RYQLILKAEDTGG Q9VAF5 528 37 -
AYELVVTARDGGS O75277 420 148 -
AYELVVTARDGGS Q9Y5H8 420 148 -
AYELVVTARDGGS O75286 420 148 -
HYSVVIQAKDMAG CADE_HUMAN 231 42 -
VYTLRIRASDWGL FATH_HUMAN 533 40 -

Motif 4 width=20
Element Seqn Id St Int Rpt
GLSNTATAVITVTDVNDNPP CAD2_MOUSE 361 4 -
SLWATASVSVEVADVNDNAP O75286 434 1 -
SLWATASVSVEVADVNDNAP Q9Y5H8 434 1 -
SLWATASVSVGVADVNDNAP O75277 434 1 -
SLWATASVSVGVADVNDNAP Q9Y5I0 434 1 -
SLWATASVSVEVADVNDNAP O75285 434 1 -
SLWATASVSVEVADVNDNAP Q9UN74 434 1 -
SLWATTSVSIEVADVNDNAP O75287 434 1 -
SLWATTSVSIEVADVNDNAP Q9Y5H9 434 1 -
SLWATARVSVEVADVNDNAP O15053 434 1 -
SLWATARVSVEVADVNDNAP Q9Y5H5 434 1 -
SLWATASVSVEVADVNDNAP O75282 434 1 -
SLWATASVSVEVADVNDNAP Q9UN72 434 1 -
SLWATARVSVEVADVNDNAP O75288 434 1 -
SLWATARVSVEVADVNDNAP Q9Y5I3 434 1 -
SLWATASVSVEVADVNDNAP O75284 433 1 -
SLWATASVSVEVADVNDNAP Q9Y5H7 433 1 -
SLWATARVSVEVADVNDNAP O75279 433 1 -
SLWATARVSVEVADVNDNAP Q9Y5I1 433 1 -
SLWATASLSVEVADVNDNAP O75281 434 1 -
SLWATASLSVEVADVNDNAP Q9Y5H6 434 1 -
SLWATASVSVEVADVNDNAP O88689 434 1 -
SLWATARVSVEVADVNDNAP O75278 434 1 -
SLWATARVSVEVADVNDNAP Q9UN75 434 1 -
SLWATASLSVEVADMNDNAP O75283 434 1 -
SLWATASLSVEVADMNDNAP Q9UN73 434 1 -
PLWATASVSVEVADVNDNAP O75280 433 1 -
PLWATASVSVEVADVNDNAP Q9Y5I2 433 1 -
GLRDRAKVLITILDVNDNVP Q9Y5D1 326 -1 -
GLRDRAKVLITILDVNDNVP Q9Y5G7 326 -1 -
SLWTTASVSVEVADVNDNAP O88690 434 1 -
GLFTTTTMLITVVDVNDNAP Q9Y5D8 327 -1 -
GLFTTTTMLITVVDVNDNAP Q9Y5H2 327 -1 -
GLFTTTTMLITVVDVNDNAP Q9Y5D9 327 -1 -
GLKGWTKVLISVEDVNDNRP Q9Y5C9 326 -1 -
GLKGWTKVLISVEDVNDNRP Q9Y5G4 326 -1 -
GLLSRAKILVTVLDVNDNAP Q9Y5D4 326 -1 -
GLLSRAKILVTVLDVNDNAP Q9Y5H0 326 -1 -
ALVASAKVVVTVQDVNDNAP Q9Y5D2 326 -1 -
ALVASAKVVVTVQDVNDNAP Q9Y5G8 326 -1 -
GLSGTTTVNITLTDVNDNPP CAD6_RAT 247 3 -
AYLATAKVLITVEDVNDNSP Q9Y5E0 330 -1 -
AYLATAKVLITVEDVNDNSP Q9Y5H3 330 -1 -
GLSGTTTVNITLTDVNDNPP CAD6_HUMAN 247 3 -
GYSARAKVLITVLDVNDNAP O60330 326 -1 -
GYSARAKVLITVLDVNDNAP Q9Y5D7 326 -1 -
GLSGTTTVNITLTDVNDNPP Q90762 247 3 -
GLMAKVKVLIKVLDVNDNAP Q9Y5D6 326 -1 -
GLMAKVKVLIKVLDVNDNAP Q9Y5H4 326 -1 -
GLSGTTTLTVTLTDVNDNPP O54800 255 3 -
GLSGTTTVNITLTDVNDNPP CAD6_MOUSE 247 3 -
GLSGKCSVSVKVLDVNDNFP Q9Y5E8 326 -1 -
GLSGKCTVVVDVTDINDNRP Q9Y5E2 326 -1 -
GLSGTTTLTVTLTDVNDNPP Q9ULB2 255 3 -
GLSGTTTLTVTLTDVNDNPP CAD8_MOUSE 255 3 -
GLSGKCTVAIEVVDVNDNAP Q9Y5E4 325 -1 -
GSLTKAKVLITVLDVNDNAP Q9Y5D0 326 -1 -
GSLTKAKVLITVLDVNDNAP Q9Y5G6 326 -1 -
GLSGKSTVIVQVVDVNDNPP Q9Y5E6 326 -1 -
SLSTDAHILLQVADINDNAP Q9Y5D5 431 1 -
SLSTDAHILLQVADINDNAP Q9Y5H1 431 1 -
GLSGTTTLTVTLTDVNDNPP CAD8_HUMAN 248 3 -
GMIAQCTVEVEVIDENDNAP Q9UN64 324 -1 -
GMIAQCTVEVEVIDENDNAP Q9UN71 324 -1 -
PLSSSIIVTLHISDVNDNAP Q9UN65 431 1 -
PLSSSIIVTLHISDVNDNAP Q9Y5G2 431 1 -
ALLGRTKLLISVEDVNDNRP O15039 326 -1 -
ALLGRTKLLISVEDVNDNRP Q9Y5G5 326 -1 -
GLSARCTVLIKVLDSNDNPP Q9NRJ8 326 -1 -
GLSARCTVLIKVLDSNDNPP Q9Y5E1 326 -1 -
GLSTQCKVIIEILDENDNSP Q9Y5C5 326 -1 -
GLSTQCKVIIEILDENDNSP Q9Y5F9 326 -1 -
GLSGTTTVNITLTDVNDNPP CADA_CHICK 248 3 -
GLVAQCTVEINIQDENDNSP Q9Y5C6 322 -1 -
GLVAQCTVEINIQDENDNSP Q9Y5G0 322 -1 -
GLSGTCVVFVQVMDLNDNPP Q9Y5E7 328 -1 -
ALSSRTSITLHISDINDNAP Q9Y5C8 427 104 -
ALSSRTSITLHISDINDNAP Q9Y5G3 427 104 -
GLFGKSTVRIQVMDVNDNAP Q9Y5F1 326 -1 -
GLSGKGTVVIEVVDVNDNPP Q9Y5E5 325 -1 -
GLSGTTTVNITLTDVNDNPP Q9Y6N8 248 3 -
GLFGKSTVIIHVIDVNDNAP Q9Y5F2 326 -1 -
GLSGTTKVTITLTDVNDNPP Q15066 247 3 -
PLSTETHISLQVMDINDNPP Q9Y5D3 431 1 -
PLSTETHISLQVMDINDNPP Q9Y5G9 431 1 -
GLSGKCSLVVRVLDVNDNAP Q9Y5E3 324 -1 -
GLSGKCTLLVKVMDINDNPP Q9Y5E9 326 -1 -
PLSSSKTITLHITDVNDNAP Q9UN63 431 104 -
PLSSSKTITLHITDVNDNAP Q9Y5F8 431 104 -
GLSGTTKVTITLTDVNDNPP CADB_HUMAN 247 3 -
GLSGTTKVTITLTDVNDNPP CADB_MOUSE 247 3 -
GLSARCRVLVEVLDTNDNPP Q9UN67 326 -1 -
GLSGTTKVTITLTDVNDNPP O93319 247 3 -
ALSTSKSIQVQVSDVNDNAP Q9Z1B1 442 1 -
GLAGTTTVNITLSDVNDNPP Q9Z0M3 253 3 -
GLSGKCTVAVQVLDVNDNAP Q63418 325 -1 -
GLAGTTTVNVTLSDVNDNPP Q91838 246 3 -
GLSGTTKVTITLTDVNDNPP O93264 247 3 -
GDSGTATVLVTLQDINDNFP CAD5_HUMAN 237 2 -
GLSGTTSVTVTLTDVNDNPP Q90763 241 3 -
GLSGTTSVTVTLTDVNDNPP Q9ULB5 241 3 -
GYSARAKVLVTVLDVNDNAP Q9Z1B0 322 -1 -
GLSAHSKVLVEVVDVNDNPP Q9Y5F3 326 -1 -
ALLGRSKVVIMVEDVNDNRP O08963 323 -1 -
PLSSSKTITLHILDVNDNVP Q9Y5C7 431 1 -
PLSSSKTITLHILDVNDNVP Q9Y5G1 431 1 -
GFSGKCTVLIQVIDVNDHAP Q9UN66 327 -1 -
GLSGTTTVNITLTDVNNNPP Q9ULB4 247 3 -
GLSNTATAVITVTDVNDNPP Q9Z1Y3 361 4 -
TFSGKCTVLIQVIDVNDHAP Q9Y5F0 327 -1 -
GLSNTATAVITVTDVNDNPP CAD2_CHICK 366 4 -
GLSNTATAVITVTDVNDNPP CAD2_HUMAN 361 4 -
GLSTTAKAVITVKDINDNAP CAD1_MOUSE 356 1 -
PLSTHRTIFLNISDVNDNPP Q9Y5C3 434 106 -
PLSTHRTIFLNISDVNDNPP Q9Y5F7 434 106 -
GLSGSTTVTIVVTDVNDNPP Q63315 253 3 -
GLSGSTTVTIVVTDVNDNPP Q63561 253 3 -
GLSGSTTVTIVVTDVNDNPP Q9WTP5 253 3 -
GLSNTATAVIAVTDVNDNPP CADO_XENLA 362 4 -
GLSTTATAVITVTDTNDNPP CAD1_HUMAN 354 1 -
GLSTTATAVITVTDTNDNPP Q15855 350 1 -
SLSALTIVRVQVSDINDNPP O60622 436 1 -
SLSALTIVRVQVSDINDNPP Q9UN70 436 1 -
SLSALTIVRVQVSDINDNPP Q9Y5C4 436 1 -
GLSGSTTVTIVVTDVNDNPP Q9UJ99 256 3 -
GLSNTATAVIAVTDVNDNPP CADN_XENLA 362 4 -
GLSTTAKAVITVKDINDNAP Q9R0T4 358 1 -
PLNSTKSFAIKILDXNDNPP O14917 451 1 -
GLSNTATAIITVTDVNDNPP CAD4_CHICK 368 4 -
GESGTATVMIRLEDINDNFP CAD5_MOUSE 234 2 -
GESGTATVMIRLEDINDNFP O35542 235 2 -
PLSAVKHILVQVSDVNDNAP O13129 436 1 -
GLSNTATAVIRLLDVNDNAP Q90275 237 4 -
SLSALTIVRVQVSDINDNPP Q08192 435 1 -
PLSSTATVLVTIHDVNDNEP Q24292 537 108 -
PLSASATVHIVVEDENDNYP O35161 453 3 -
VLQGSTTVIVQVADKNDNDP O60245 618 1 -
VLQGSTTVIVQVADKNDNDP O60246 618 1 -
VLQGSTTVIVQVADKNDNDP O60247 571 1 -
VLQGSTTVIVQVADKNDNDP O88185 618 1 -
GLAGTTIVNITLTDVNDNPP CADC_HUMAN 248 3 -
ALTASASVSVTILDVNDNNP Q9R0M0 590 108 -
GLSTTATAVITVTDTNDNPP Q9UII7 354 1 -
QLTSLRTLKVEISDINDNPP Q9Y5F4 448 1 -
QLTSLRTLKVEISDINDNPP Q9Y5I4 448 1 -
PLSASASVTVTVLDVNDNRP Q9NYQ7 735 214 -
PLSATATVYIEVEDENDNYP Q9NYQ6 438 3 -
GLSNTATAIITVTDVNDNPP CAD4_MOUSE 368 4 -
GLSVEGKAIIQITDANDNAP CADF_XENLA 370 1 -
DRTTTATALIVVMDTNDNPP CAD1_XENLA 349 2 -
SLHKHLTIRLNISDVNDNAP Q9Y5C2 433 105 -
SLHKHLTIRLNISDVNDNAP Q9Y5F6 433 105 -
PRSATVRVHITVLDENDNAP O88278 515 3 -
GLSNTATAIIEVTDANDNIP CAD1_CHICK 360 1 -
VLQGATSVVVQVADRNDNEP O57537 590 1 -
GLSNTATAIITVADVNDNPP P79883 377 4 -
PLSTRRTITVSVADVNDNTP Q9Y5F5 424 1 -
PLSTRRTITVSVADVNDNTP Q9Y5I5 424 1 -
WLSSTVLLKVSLDDVNDNPP Q9WU10 907 360 -
PLSAEKELQIQVSDVNDNAP O55134 439 109 -
PQSATATVWLNVADVNDNDP FAT_DROME 687 215 -
GLTGTATATILIDDKNDHPP CADD_CHICK 342 3 -
GLTGTATATILIDDKNDHPP Q91353 342 3 -
GLTAEGKAVIEITDANDNAP CADB_XENLA 378 1 -
GLSGYAHLTVLVADVNDNAP Q9VEU1 1030 -1 -
ALTATADVVVDIINLNDNDP Q9VGG5 1058 210 -
PLSAKKQLSIQISDINDNAP Q9NPG4 439 109 -
PKSASSSVVITVQDVNDNDP Q9V5N8 773 106 -
SLQGTATVLVNVLDCNDNDP Q08174 557 1 -
GSTTTAVAVVEILDANDNAP CAD3_HUMAN 307 1 -
VLSSEALVYVLVDDVNDNAP Q9VW71 956 1 -
MLSTVVPVLIYVQDVNDNAP Q9VFH5 725 1 -
PETATTTVYVNVKDINDERP Q9VVG0 794 229 -
ELTGTVQLLVTVLDVNDNAP Q9NRT8 230 1 -
GLTGTATATIMIDDKNDHSP CADD_HUMAN 342 3 -
GLHTTAKCIITIEDVNDNLP DSC2_MOUSE 334 3 -
SVSSTCRAIVDIIDVNDNAP O93508 321 1 -
GLFTTGTITISLEDENDNSP DSC1_MOUSE 333 3 -
GLTGTATATIVIDDKNDHSP Q9WTR5 342 3 -
GLFNTGTITISLEDENDNPP DSC1_HUMAN 333 3 -
SLNTSTTIAVVLKDINDNAP Q19482 560 1 -
GSTTTAEAVVQILDANDNAP CAD3_MOUSE 299 1 -
ELQGTVELLITVLDVNDNAP Q9NRT7 221 1 -
PLTSNVTVFVSIIDQNDNSP Q9P2X5 549 1 -
SLEGVCSFTVEITDVNDNPP O15943 1057 118 -
SLSATSKILIHVGDINDNTP Q9TWY4 1731 1017 -
SLSATSKILIHVGDINDNTP YOG7_CAEEL 1735 1019 -
PLTATCKVTVHILDVNDNTP O93509 325 1 -
GLFNTGTITISLEDENDNAP DSC1_BOVIN 331 3 -
PKSSWKLLTVTVKDWNDNPP O88277 799 151 -
PLRTVRPYTVRVGDENDNAP Q9WVR2 476 1 -
PLRTVRPYTVRVGDENDNAP O95206 476 1 -
GLQTTSTCIINIDDVNDHLP DSC2_HUMAN 334 3 -
QKSSWKLLTVNVKDWNDNAP Q9NYQ8 799 151 -
PRSSNMTLFIHVLDVNDNAP O01912 336 1 -
PLIGFCQFSVEVVDINDNSP Q9XWM6 593 234 -
PLSYPLEIHVKVKDINDNPP Q12864 319 100 -
EFTGSVSLLILVLDANDNAP Q9NRU2 220 1 -
GLSTQCECNIKVKDVNDNFP DSG3_HUMAN 246 1 -
PLAYPLEIYVKVIDINDNPP Q9R100 318 100 -
PLAYPLEIRVKVIDINDNPP CADL_RAT 318 100 -
NMKSFATFSVNINDENDNSP Q19319 1461 214 -
GLSSSATVNIKVTDINDKNP Q9VAF5 540 -1 -
GLSGSTTVNITLTDVNDNPP CADE_HUMAN 247 3 -
QLFSTVVVKVSLEDVNDNPP FATH_HUMAN 906 360 -

Motif 5 width=14
Element Seqn Id St Int Rpt
PAFAQPEYTVFVKE Q9Y5I1 452 -1 -
PAFAQPEYTVFVKE O75281 453 -1 -
PAFAQPEYTVFVKE Q9Y5H6 453 -1 -
PVFAQPEYTVFVKE O88689 453 -1 -
PAFAQPEYTVFVKE O75278 453 -1 -
PAFAQPEYTVFVKE Q9UN75 453 -1 -
PAFAQPEYTVFVKE O75283 453 -1 -
PAFAQPEYTVFVKE Q9UN73 453 -1 -
PAFAQSEYTVFVKE O75280 452 -1 -
PAFAQSEYTVFVKE Q9Y5I2 452 -1 -
PTFPHSSYSVYVLE Q9Y5D1 450 104 -
PTFPHSSYSVYVLE Q9Y5G7 450 104 -
PSFAQPDYTVFVKE O88690 453 -1 -
PVFPHSSYSAYIPE Q9Y5D8 451 104 -
PVFPHSSYSAYIPE Q9Y5H2 451 104 -
PVFPHSSYSAYIPE Q9Y5D9 451 104 -
PAFSQASYSVYLPE Q9Y5C9 450 104 -
PAFSQASYSVYLPE Q9Y5G4 450 104 -
PTFPHLSYSAYIPE Q9Y5D4 450 104 -
PTFPHLSYSAYIPE Q9Y5H0 450 104 -
PNFPQASYSTSVTE Q9Y5D2 450 104 -
PNFPQASYSTSVTE Q9Y5G8 450 104 -
PRFPQSTYQFKTPE CAD6_RAT 266 -1 -
PTFSQVSYFTYIPE Q9Y5E0 454 104 -
PTFSQVSYFTYIPE Q9Y5H3 454 104 -
PRFPQSTYQFKTPE CAD6_HUMAN 266 -1 -
PVFPQASYSAYIPE O60330 450 104 -
PVFPQASYSAYIPE Q9Y5D7 450 104 -
PRFPQSTYQFRAPE Q90762 266 -1 -
PVFHQDSYSAYIPE Q9Y5D6 450 104 -
PVFHQDSYSAYIPE Q9Y5H4 450 104 -
PKFAQSLYHFSVPE O54800 274 -1 -
PRFPQSTYQFKTPE CAD6_MOUSE 266 -1 -
PAFTQTSYTLFVRE Q9Y5E8 449 103 -
PAFTQTSYTLFVRE Q9Y5E2 449 103 -
PKFAQSLYHFSVPE Q9ULB2 274 -1 -
PKFAQSLYHFSVPE CAD8_MOUSE 274 -1 -
PAFTQTSYTLFVRE Q9Y5E4 448 103 -
PTFPHSSYSVYIAE Q9Y5D0 450 104 -
PTFPHSSYSVYIAE Q9Y5G6 450 104 -
PAFTQISYTLFVRE Q9Y5E6 449 103 -
PAFSRTSYSTYIPE Q9Y5D5 450 -1 -
PAFSRTSYSTYIPE Q9Y5H1 450 -1 -
PKFAQSLYHFSVPE CAD8_HUMAN 267 -1 -
PVFSQSSYIVHVAE Q9UN64 448 104 -
PVFSQSSYIVHVAE Q9UN71 448 104 -
PVFQQTSYMVHVAE Q9UN65 450 -1 -
PVFQQTSYMVHVAE Q9Y5G2 450 -1 -
PTFPHASYSAYILE O15039 450 104 -
PTFPHASYSAYILE Q9Y5G5 450 104 -
PAFTQTSYTLFVRE Q9NRJ8 449 103 -
PAFTQTSYTLFVRE Q9Y5E1 449 103 -
PVFDQTSYVVHVAE Q9Y5C5 450 104 -
PVFDQTSYVVHVAE Q9Y5F9 450 104 -
PRFPQSTIHLRIPE CADA_CHICK 267 -1 -
PVFHQASYLVSVPE Q9Y5C6 446 104 -
PVFHQASYLVSVPE Q9Y5G0 446 104 -
PAFTQTSYTLFVRE Q9Y5E7 451 103 -
PVFHQASYVVHVSE Q9Y5C8 446 -1 -
PVFHQASYVVHVSE Q9Y5G3 446 -1 -
PAFTQTSYALFVRE Q9Y5F1 449 103 -
PAFTQTSYTLFVRE Q9Y5E5 448 103 -
PRFPQNTIHLRVLE Q9Y6N8 267 -1 -
PTFTQTSYTLFVRE Q9Y5F2 449 103 -
PKFPQSVYQISVSE Q15066 266 -1 -
PTFPHASYSAYIPE Q9Y5D3 450 -1 -
PTFPHASYSAYIPE Q9Y5G9 450 -1 -
PAFTQTSYTLFVRE Q9Y5E3 447 103 -
PTFTQTSYTLFVRE Q9Y5E9 449 103 -
PVFGQSAYLVHVPE Q9UN63 450 -1 -
PVFGQSAYLVHVPE Q9Y5F8 450 -1 -
PKFPQRLYQMSVSE CADB_HUMAN 266 -1 -
PKFPQSVYQMSVSE CADB_MOUSE 266 -1 -
PAFTQTSYTLFVRE Q9UN67 449 103 -
PKFPQSVYQMSVSE O93319 266 -1 -
PRFSQPVYDVYVTE Q9Z1B1 461 -1 -
PRFPQKHYQMSVLE Q9Z0M3 272 -1 -
PAFTQTSYTMFVHE Q63418 448 103 -
PRFPQKHYQMSVLE Q91838 265 -1 -
PKFPQSAYPMSVSE O93264 266 -1 -
PFFTQTKYTFVVPE CAD5_HUMAN 256 -1 -
PRFPRRSYQYNVPE Q90763 260 -1 -
PRFPRRSYQYNVPE Q9ULB5 260 -1 -
PVFLQASYWAYIPE Q9Z1B0 446 104 -
PIFREDSYILTVRE Q9Y5F3 450 104 -
PRFPHTSYTAYIPE O08963 446 103 -
PVFHQASYTVHVAE Q9Y5C7 450 -1 -
PVFHQASYTVHVAE Q9Y5G1 450 -1 -
PAFTQTSYTLFVRE Q9UN66 450 103 -
PRFPQSTYQFNSPE Q9ULB4 266 -1 -
PEFTAMTFYGEVPE CAD2_MOUSE 380 -1 -
PEFTAMTFYGEVPE Q9Z1Y3 380 -1 -
PAFTQTSYTLFVRE Q9Y5F0 449 102 -
PEFTAMTFYGEVPE CAD2_CHICK 385 -1 -
PEFTAMTFYGEVPE CAD2_HUMAN 380 -1 -
PVFNPSTYQGQVPE CAD1_MOUSE 375 -1 -
PSFFQRSHEVFVPE Q9Y5C3 453 -1 -
PSFFQRSHEVFVPE Q9Y5F7 453 -1 -
PRFPQKMYQFSIQE Q63315 272 -1 -
PRFPQKMYQFSIQE Q63561 272 -1 -
PRFPQKMYQFSIQE Q9WTP5 272 -1 -
PEFTAMTFYGEVPE CADO_XENLA 381 -1 -
PIFNPTTYKGQVPE CAD1_HUMAN 373 -1 -
PIFNPTTYKGQVPE Q15855 369 -1 -
PQSSQSSYDVYIEE O60622 455 -1 -
PQSSQSSYDVYIEE Q9UN70 455 -1 -
PQSSQSSYDVYIEE Q9Y5C4 455 -1 -
PRFPQKMYQFSIQE Q9UJ99 275 -1 -
PEFTAMTFYGEVPE CADN_XENLA 381 -1 -
PIFNPSTYQGQVLE Q9R0T4 377 -1 -
PRFTKGLYVLQVHE O14917 470 -1 -
PEFTTSTYSGEVPE CAD4_CHICK 387 -1 -
PVFTQSTYTFSVPE CAD5_MOUSE 253 -1 -
PVFTQSTYTFSVPE O35542 254 -1 -
PKSSQDSYDVYVLE O13129 455 -1 -
PEFTRETFHGEVPE Q90275 256 -1 -
PQSSQSSYDVYIEE Q08192 454 -1 -
PIFDQSFYNVSVAE Q24292 556 -1 -
PQFSEKRYVVQVPE O35161 472 -1 -
PKFMQDVFTFYVKE O60245 637 -1 -
PKFMQDVFTFYVKE O60246 637 -1 -
PKFMQDVFTFYVKE O60247 590 -1 -
PKFMQDVFTFYVKE O88185 637 -1 -
PRFPKSIFHLKVPE CADC_HUMAN 267 -1 -
PTFTQPEYTVRLNE Q9R0M0 609 -1 -
PIFNPTTYKGQVPE Q9UII7 373 -1 -
PSFLEDSYSIYIQE Q9Y5F4 467 -1 -
PSFLEDSYSIYIQE Q9Y5I4 467 -1 -
PVFQSAHYSVSVNE Q9NYQ7 856 101 -
PQFSEQNYVVQVPE Q9NYQ6 457 -1 -
PEFTTSTFAGEVPE CAD4_MOUSE 387 -1 -
PIFDPKTYTALVPE CADF_XENLA 389 -1 -
PVFDPTQYTAKVPE CAD1_XENLA 368 -1 -
PRFNQQLYTAYILE Q9Y5C2 452 -1 -
PRFNQQLYTAYILE Q9Y5F6 452 -1 -
PQFSEKRYVAQVRE O88278 534 -1 -
PIFNPTMYEGVVEE CAD1_CHICK 379 -1 -
PKFMQDVFTFYVKE O57537 609 -1 -
PEFTRKMFIGEVPE P79883 396 -1 -
PNFPQPQQELFVAE Q9Y5F5 443 -1 -
PNFPQPQQELFVAE Q9Y5I5 443 -1 -
PRFIPPSYSVKVRE Q9WU10 926 -1 -
PVFEKSRYEVSTWE O55134 458 -1 -
PVFDHTSYETSLPE FAT_DROME 1047 340 -
PEFTKKEFQATVKE CADD_CHICK 361 -1 -
PEFTKKEFQATVKE Q91353 361 -1 -
PIFDPKTYTALVPE CADB_XENLA 397 -1 -
PTFKKSWYSFDTPE Q9VEU1 1246 196 -
PKFSQSDYYFNVTE Q9VGG5 1077 -1 -
PVFEKSRYEVSTRE Q9NPG4 458 -1 -
PIFENAPYSASVFE Q9V5N8 895 102 -
PKFMLSGYNFSVME Q08174 576 -1 -
PMFDPQKYEAHVPE CAD3_HUMAN 326 -1 -
PVFGVQEYIFKVRE Q9VW71 975 -1 -
PIFQQSFYAKTVPE Q9VFH5 744 -1 -
PKFEQNSYATYVSE Q9VVG0 813 -1 -
PTFEQSEYEVRIFE Q9NRT8 249 -1 -
PKFTKKEFQATVEE CADD_HUMAN 361 -1 -
PTFTRTTYVTSVEE DSC2_MOUSE 353 -1 -
PLFSKSIYDVSVIE O93508 451 110 -
PYFTQTSYTTEVEE DSC1_MOUSE 352 -1 -
PKFTKKEFQARVEE Q9WTR5 361 -1 -
PSFTETSYVTEVEE DSC1_HUMAN 352 -1 -
PTFDKKEYNVTISE Q19482 579 -1 -
PEFEPQKYEAWVPE CAD3_MOUSE 318 -1 -
PLFDQAVYRVHLLE Q9NRT7 240 -1 -
PVFTHNEYNFYVPE Q9P2X5 568 -1 -
PYFDKSLYEAEVDE O15943 1412 335 -
PRFDQQLYRFNVTE Q9TWY4 2039 288 -
PRFDQQLYRFNVTE YOG7_CAEEL 2043 288 -
PVFSKPQYEASILE O93509 455 110 -
PYFTETSYTVEVEE DSC1_BOVIN 350 -1 -
PRFPPGGYQLTISE O88277 818 -1 -
PLFTKPVYEVSVRE Q9WVR2 495 -1 -
PLFTRPVYEVSVRE O95206 495 -1 -
PTFTRTSYVTSVEE DSC2_HUMAN 353 -1 -
PRFPPGGYQLTISE Q9NYQ8 818 -1 -
PEFEKSWYTMEVLE O01912 355 -1 -
PAFAQPEYTVFVKE Q9Y5H9 453 -1 -
PSFEEQKYIGRVKE Q9XWM6 985 372 -
PQFSQHVFQAKVSE Q12864 564 225 -
PIFDRPVYEVKMYE Q9NRU2 239 -1 -
PMFRDSQYSARIEE DSG3_HUMAN 265 -1 -
PVFPQRIFQANVSE Q9R100 563 225 -
PVFPQQIFQANVSE CADL_RAT 563 225 -
PVFEKLKYTASTPE Q19319 2199 718 -
LAFSDDSYTTSVPE Q9VAF5 892 332 -
PAFAQSEYTVFVKE O15053 453 -1 -
PAFAQSEYTVFVKE Q9Y5H5 453 -1 -
PAFAQPEYTVFVKE O75282 453 -1 -
PAFAQPEYTVFVKE Q9UN72 453 -1 -
PAFAQPEYTVFVKE O75288 453 -1 -
PAFAQPEYTVFVKE Q9Y5I3 453 -1 -
PAFAQPQYTVFVKE O75284 452 -1 -
PAFAQPEYTVFVKE O75287 453 -1 -
PAFAQPEYTVFVKE Q9UN74 453 -1 -
PAFSQSEYTVFVKE O75286 453 -1 -
PTFIPPNYRVKVRE FATH_HUMAN 925 -1 -
PAFAQPEYTVFVKE O75277 453 -1 -
PAFAQPEYTVFVKE Q9Y5I0 453 -1 -
PAFAQPEYTVFVKE O75285 453 -1 -
PAFSQSEYTVFVKE Q9Y5H8 453 -1 -
PRFPQKHYQLYVPE CADE_HUMAN 266 -1 -
PAFAQPQYTVFVKE Q9Y5H7 452 -1 -
PAFAQPEYTVFVKE O75279 452 -1 -

Motif 6 width=27
Element Seqn Id St Int Rpt
DSGVLRAVRSLDYEKLKQLDFEIEAAD O93509 515 46 -
ESGKVYALQPLDHEELELLQFQVSARD O75286 513 46 -
ESGKVYALQPLDHEELELLQFQVSARD Q9Y5H8 513 46 -
ESGKVYALQPLDHEELELLQFQVSARD O75277 513 46 -
ESGKVYALQPLDHEELELLQFQVSARD Q9Y5I0 513 46 -
ESGKVYALQPLDHEELELLQFQVTARD O75285 513 46 -
ESGKVYALQPLDHEELELLQFQVTARD Q9UN74 513 46 -
ESGKVYALQPLDHEEVELLQFQVSARD O75287 513 46 -
ESGKVYALQPLDHEEVELLQFQVSARD Q9Y5H9 513 46 -
ESGKVYALQPLDHEELELLQFQVSARD O15053 513 46 -
ESGKVYALQPLDHEELELLQFQVSARD Q9Y5H5 513 46 -
ESGKVYALQPLDHEELELLQFQVSARD O75282 513 46 -
ESGKVYALQPLDHEELELLQFQVSARD Q9UN72 513 46 -
ESGKVYALQPLDHEELELLQFQVSARD O75288 513 46 -
ESGKVYALQPLDHEELELLQFQVSARD Q9Y5I3 513 46 -
ESGKVYALQPLDHEEVELLQFQVSARD O75284 512 46 -
ESGKVYALQPLDHEEVELLQFQVSARD Q9Y5H7 512 46 -
ESGKVYALQPLDHEELELLQFQVSARD O75279 512 46 -
ESGKVYALQPLDHEELELLQFQVSARD Q9Y5I1 512 46 -
ESGKVYALQPLDHEELELLQFQVSARD O75281 513 46 -
ESGKVYALQPLDHEELELLQFQVSARD Q9Y5H6 513 46 -
ESGKVFALQPLDHEELELLRFQVSARD O88689 513 46 -
ESGKVYALQPLDHEELELLQFQVSARD O75278 513 46 -
ESGKVYALQPLDHEELELLQFQVSARD Q9UN75 513 46 -
ESGKVYALQPLDHEELELLQFQVSARD O75283 513 46 -
ESGKVYALQPLDHEELELLQFQVSARD Q9UN73 513 46 -
ESGKVYALQPLDHEELELLQFQVSARD O75280 512 46 -
ESGKVYALQPLDHEELELLQFQVSARD Q9Y5I2 512 46 -
DTGILYALRSFDYEQLRDLQLWVTASD Q9Y5D1 510 46 -
DTGILYALRSFDYEQLRDLQLWVTASD Q9Y5G7 510 46 -
ESGKVFALQPLDHEELELLQFQVSARD O88690 513 46 -
NTGVLYALQSFDYEQFRDLELRVIARD Q9Y5D8 511 46 -
NTGVLYALQSFDYEQFRDLELRVIARD Q9Y5H2 511 46 -
NTGVLYALQSFDYEQFRDLELRVIARD Q9Y5D9 511 46 -
DTGVLYALCSFDYEQFRDLQMQVTASD Q9Y5C9 510 46 -
DTGVLYALCSFDYEQFRDLQMQVTASD Q9Y5G4 510 46 -
NTGVLYALRSFDYEQFRDLKLLVTASD Q9Y5D4 510 46 -
NTGVLYALRSFDYEQFRDLKLLVTASD Q9Y5H0 510 46 -
DTGVLYALRSFDYEQLRDLQLWVTASD Q9Y5D2 510 46 -
DTGVLYALRSFDYEQLRDLQLWVTASD Q9Y5G8 510 46 -
QEGIITVKKLLDFEKKRVYTLKVEASN CAD6_RAT 325 45 -
DTGVLYALRSFDYEQFHELQMQVTASD Q9Y5E0 514 46 -
DTGVLYALRSFDYEQFHELQMQVTASD Q9Y5H3 514 46 -
QEGIITVKKLLDFEKKKVYTLKVEASN CAD6_HUMAN 325 45 -
DTGVLYALSSFDYEQFRDLQVKVMARD O60330 510 46 -
DTGVLYALSSFDYEQFRDLQVKVMARD Q9Y5D7 510 46 -
QEGIITVKKALDFENKNLYILKVEATN Q90762 325 45 -
DTGVLYALRSFDYEQFRDMQLKVMARD Q9Y5D6 510 46 -
DTGVLYALRSFDYEQFRDMQLKVMARD Q9Y5H4 510 46 -
QDGVIRLRKPLDFETKKSYTLKVEAAN O54800 333 45 -
QEGIITVKKLLDFEKKKVYTLRWKASN CAD6_MOUSE 325 45 -
DNGHLFALQSLDYEALQAFEFRVGATD Q9Y5E8 509 46 -
DNGHLFALRSLDYEALQAFEFRVGATD Q9Y5E2 509 46 -
QDGIIRLRKPLDFETKKSYTLKVEAAN Q9ULB2 333 45 -
QDGVIRLRKPLDFETKKSYTLKVEAAN CAD8_MOUSE 333 45 -
DNGHLFALRSLDYEALQAFEFRVGATD Q9Y5E4 508 46 -
DTGVLYALQSFDYEQLRELQLRVTAHD Q9Y5D0 510 46 -
DTGVLYALQSFDYEQLRELQLRVTAHD Q9Y5G6 510 46 -
DNGHLFALRSLDYEALQAFEFRVGATD Q9Y5E6 509 46 -
DTGVLYALRSFDYEQLRDLQVWVIARD Q9Y5D5 510 46 -
DTGVLYALRSFDYEQLRDLQVWVIARD Q9Y5H1 510 46 -
QDGIIRLRKPLDFETKKSYTLKDEAAN CAD8_HUMAN 326 45 -
ESGVVFAQRAFDHEQLRAFELTLQARD Q9UN64 508 46 -
ESGVVFAQRAFDHEQLRAFELTLQARD Q9UN71 508 46 -
QSGVVFAQRAFDHEQLRAFELTLQARD Q9UN65 510 46 -
QSGVVFAQRAFDHEQLRAFELTLQARD Q9Y5G2 510 46 -
DTGVLYALQSFDYEQIRDLQLLVTASD O15039 510 46 -
DTGVLYALQSFDYEQIRDLQLLVTASD Q9Y5G5 510 46 -
DNGHLFALRSLDYEALQAFDFRVGASD Q9NRJ8 509 46 -
DNGHLFALRSLDYEALQAFDFRVGASD Q9Y5E1 509 46 -
QSGVVFAQRAFDHEQLRAFALTLQARD Q9Y5C5 510 46 -
QSGVVFAQRAFDHEQLRAFALTLQARD Q9Y5F9 510 46 -
QEGIITVRKPLDYETRRLYTLKVEAEN CADA_CHICK 326 45 -
QSGVVFAQRAFDYEQLRTFELTLQARD Q9Y5C6 506 46 -
QSGVVFAQRAFDYEQLRTFELTLQARD Q9Y5G0 506 46 -
DNGHLFALQSLDYEALQAFEFRVGAAD Q9Y5E7 511 46 -
QSGVVFAQRAFDHEQLRAFELTLQARD Q9Y5C8 506 46 -
QSGVVFAQRAFDHEQLRAFELTLQARD Q9Y5G3 506 46 -
DNGHLFALRSLDYEALQGFQFRVGATD Q9Y5F1 509 46 -
DNGHLFALRSLDYEALQAFEFRVGASD Q9Y5E5 508 46 -
QEGIITVKKPLDYESRRLYTLKVEAEN Q9Y6N8 326 45 -
DNGHLFALRSLDYEALQAFDFRVGATD Q9Y5F2 509 46 -
QEGVIKLKKPVDFETKRAYSLKVEAAN Q15066 325 45 -
NTGILYALCSFDYEQFRDLQLLMTASD Q9Y5D3 510 46 -
NTGILYALCSFDYEQFRDLQLLMTASD Q9Y5G9 510 46 -
DNGHLFALRSLDYEALQSFEFRVGATD Q9Y5E3 507 46 -
DNGHLFALRSLDYEALQEFEFRVGATD Q9Y5E9 509 46 -
QSGVVFAQRAFDHEQLRTFELTLQARD Q9UN63 510 46 -
QSGVVFAQRAFDHEQLRTFELTLQARD Q9Y5F8 510 46 -
QEGVIKLKKPVDFETERAYSLKVEAAN CADB_HUMAN 325 45 -
QDGVVKLKKPVDFETKRAYSLKIEAAN CADB_MOUSE 325 45 -
DNGHLFALRSLDYEALQAFEFRVGATD Q9UN67 509 46 -
QEGVVKLKKVLDFETKKSYSLKVEAAN O93319 325 45 -
DNGYLYALRSFDYEQIKDFSFQVEARD Q9Z1B1 521 46 -
QVGIITVKKPLSFESKKSYTLKVEGSN Q9Z0M3 331 45 -
DNGQLFALRALDYEALQSFEFYVGATD Q63418 508 46 -
QVGVITVKKPLDFETKKSYTLKIEGSN Q91838 324 45 -
QEGVVKLKKVVDYETKKFYSMKVEAVN O93264 325 45 -
NEGIIKPMKPLDYEYIQQYSFIVEATD CAD5_HUMAN 315 45 -
QEGIITIQKELDFEAKTSYTLRIEAAN Q90763 319 45 -
QEGIITIQKELDFEAKTSYTLRIEAAN Q9ULB5 319 45 -
DTGVLYALHSFDYEQFPDLQLQVIARD Q9Z1B0 506 46 -
GNGKLYALRTMDYEAIQDFQFVVKATD Q9Y5F3 510 46 -
DTGVLYALHSFDFEKIQDLQLLVVATD O08963 506 46 -
RSGVVFAQRAFDHEQLRAFELTLQARD Q9Y5C7 510 46 -
RSGVVFAQRAFDHEQLRAFELTLQARD Q9Y5G1 510 46 -
DNGHLFALRSLDYEALQAFEFRVGASD Q9UN66 510 46 -
QEGIITVKQNLDFENQMLYTLRVDASN Q9ULB4 325 45 -
NDGLVTVVKPIDFETNRMFVLTVAAEN CAD2_MOUSE 440 46 -
NDGLVTVVKPIDFETNRMFVLTVAAEN Q9Z1Y3 440 46 -
DNGHLFALRSLDYEALQGFQFRVGASD Q9Y5F0 509 46 -
NDGLVTVVKPIDFETNRMFVLTVAAEN CAD2_CHICK 445 46 -
NDGLVTVVKPIDFETNRMFVLTVAAEN CAD2_HUMAN 440 46 -
NDGILKTAKGLDFEAKQQYILHVRVEN CAD1_MOUSE 434 45 -
QTGAVHATRSFDYEQTQTLQFEVQARD Q9Y5C3 513 46 -
QTGAVHATRSFDYEQTQTLQFEVQARD Q9Y5F7 513 46 -
QEAIIVVQKHLDFESQQVHTVVLEALN Q63315 333 47 -
QEAIIVVQKHLDFESQQVHTVVLEALN Q63561 333 47 -
QEAIIVVQKHLDFESQQVHTVVLEALN Q9WTP5 333 47 -
NDGLVTVVKPIDYETKSTYILTVVAEN CADO_XENLA 441 46 -
NDGILKTAKGLDFEAKQQYILHVAVTN CAD1_HUMAN 432 45 -
NDGILKTAKGLDFEAKQQYILHVAVTN Q15855 428 45 -
DNGIVSSLVPLDYEDRREFELTAHISD O60622 515 46 -
DNGIVSSLVPLDYEDRREFELTAHISD Q9UN70 515 46 -
DNGIVSSLVPLDYEDRREFELTAHISD Q9Y5C4 515 46 -
QEAIIVVQKRLDFESQPVHTVILEALN Q9UJ99 336 47 -
NDGLVTVVKPIDYETKSTYILTVVAEN CADN_XENLA 441 46 -
NEGILKTAKGLDFEAKQQYILHVTVEN Q9R0T4 436 45 -
TNGAIYALRSFNFEQTKAFEFKVLAKD O14917 530 46 -
NEGMVTVVKAVDYEMNRAFMLTVMVSN CAD4_CHICK 447 46 -
NEGIIKPTKSLDYEVIQQYTFYIEATD CAD5_MOUSE 312 45 -
NEGIIKPTKSLDYEVIQQYTFYIEATD O35542 313 45 -
ESGALHLLTSLDHEDQMEFSMMVQVQD O13129 512 43 -
NEGLVTVVKPVDFEMNRSFMLTVVADN Q90275 316 46 -
DNGIVSSLVPLDYEDRREFELTAHISD Q08192 514 46 -
RSGHLILSQHLDYESSQRHTLIVTATD Q24292 931 361 -
LSGSLDVINPLDFEAIREYTLRIKAQD O35161 527 41 -
DTGTIYSTMSFDREHQTTYTFRVKAVD O60245 690 39 -
DTGTIYSTMSFDREHQTTYTFRVKAVD O60246 690 39 -
DTGTIYSTMSFDREHQTTYTFRVKAVD O60247 643 39 -
DTGTIYSTMSFDREHQTTYTFRVKAVD O88185 690 39 -
QEGVIKLKKPLDFETKKAYTFKVEASN CADC_HUMAN 326 45 -
DTGAVTTQAELDYEDQVSYTLAITARD Q9R0M0 764 141 -
HSCSYPCPLGLDFEAKQQYILHVAVTN Q9UII7 451 64 -
ASGSLYAVNSFDYEKFREFFVTVEAQD Q9Y5F4 527 46 -
ASGSLYAVNSFDYEKFREFFVTVEAQD Q9Y5I4 527 46 -
DSGAITLQAPLDYEDQVTYTLAITARD Q9NYQ7 909 39 -
LSGILDVINPLDFEDVQKYSLSIKAQD Q9NYQ6 512 41 -
NEGMVTVVKAVDYELNRAFMLTVMVSN CAD4_MOUSE 447 46 -
NQGILTTAKGLDFELRKQYVLQITVEN CADF_XENLA 448 45 -
NIGLLKTVKGLDYELKKQYILSVIVTN CAD1_XENLA 427 45 -
EDGRIFAQRTFDYELLQMLQIVVGVRD Q9Y5C2 512 46 -
EDGRIFAQRTFDYELLQMLQIVVGVRD Q9Y5F6 512 46 -
LTGEIQVMAPLDFEAEREYALRIRAQD O88278 589 41 -
NNGILKTAKGLDYETKSRYDLVVTVEN CAD1_CHICK 439 46 -
ETGTIYSTVSFDREHQTSYTFRVKAVD O57537 662 39 -
NEGIVTVSKPVDYEMSKVFPLIVMVTN P79883 456 46 -
SSGAITAKTSFDFEQLRGFHFQVEGRD Q9Y5F5 503 46 -
SSGAITAKTSFDFEQLRGFHFQVEGRD Q9Y5I5 503 46 -
LSGAVRIVQQLDFEKKQLYNLTVRAKD Q9WU10 980 40 -
ETGEVTAQRSLDYEQMAGFEFQVIAED O55134 513 41 -
PDGYLFVRAPLDREERDYYALTVSCRD FAT_DROME 1101 40 -
NEGMLSVVKPLDYEISAFHTLLIKVEN CADD_CHICK 420 45 -
NEGMLSVVKPLDYEISAFHTLLIKVEN Q91353 420 45 -
NQGILTTAKGLDFEVRKQYVIQITVEN CADB_XENLA 456 45 -
ASGVLKIGGQLDRELKDKYSFQVIATD Q9VEU1 1299 39 -
GNVMVANSSILDREQIKELTLSVVAQD Q9VGG5 1133 42 -
NTGEVTAQRSLNYEEMAGFEFQVIAED Q9NPG4 513 41 -
QTGAIVTNAPLDRETTSGYLLTVTAKD Q9V5N8 955 46 -
GTGTILSSLSFDREQQSTYTFQLKAVD Q08174 629 39 -
NQGILTTRKGLDFEAKNQHTLYVEVTN CAD3_HUMAN 386 46 -
HTGAIRTQGYLDYENKQVHNLIVSAID Q9VW71 1031 42 -
DTGVLTVADRLDRESKDSYNLVIEAWD Q9VFH5 1158 400 -
GEIIVASGQTIDRERTPRIQLQIKAED Q9VVG0 1115 288 -
NYYSLVLDSALDRESVSAYELVVTARD Q9NRT8 412 149 -
NEGMLSVVKPLDYEISAFHTLLIKVEN CADD_HUMAN 420 45 -
NEGILCVIKPLDYEERQQVTLQIGVVN DSC2_MOUSE 413 46 -
HSGSLYTLRSFDFETLKDVQFSVKATD O93508 512 47 -
NEGVLCVVKPLNYEVSRQVTLQIGVLN DSC1_MOUSE 412 46 -
NEGMLSVVKPLDYEISAFHTLLIKVEN Q9WTR5 420 45 -
NEGVLCVVKPLNYEVNRQVILQVGVIN DSC1_HUMAN 412 46 -
SSGDISVSSDLDREDRATFSVIVTASD Q19482 765 172 -
NQGVLTTKKGLDFEAQDQHTLYVEVTN CAD3_MOUSE 378 46 -
SSGEIRLIDKLDYEETKSYEIQVKAVD Q9NRT7 298 44 -
QTGVIRPNISFDREKQESYTFYVKAED Q9P2X5 621 39 -
MTGAIYVAGALDYETRRRYELRLAASD O15943 1465 39 -
ESGQIESVRDLDRETKSEYHLIVEAID Q9TWY4 2090 37 -
ESGQIESVRDLDRETKSEYHLIVEAID YOG7_CAEEL 2094 37 -
NEAVLCVVKPLNYEVNRQVVLQIGVLN DSC1_BOVIN 410 46 -
DTGMLETLAPLDREFTPYYWLTVLAVD O88277 1085 253 -
ATGAIYALRSFDYETLRQLDVRVQASD Q9WVR2 557 48 -
ATGAIYALRSFDYETLRQLDVRIQASD O95206 557 48 -
NEGVLCVVKPLNYEEKQQMILQIGVVN DSC2_HUMAN 413 46 -
LTGELVVTGHLDRESEPRYILKVEARD Q9NYQ8 871 39 -
FTGTIHLTAPLDFEVLPEHTLTIKATD O01912 1395 1026 -
DSGTIFVKEPLDFEASDQYHLVLIASD Q9XWM6 1039 40 -
VTGEIFSVAPLDREAGSPYRVQVVATE Q12864 615 37 -
NYYSLVLDSALDRERVSAYELVVTARD Q9NRU2 402 149 -
NEGILKVVKALDYEQLQSVKLSIAVKN DSG3_HUMAN 325 46 -
VTGEIFSAAPLDRETESVYRVQVVATE Q9R100 614 37 -
VTGDIFSTAPLDRETESVYRVQVVATE CADL_RAT 614 37 -
ETGDVTITGQLDYEKTQKYDLKLVATS Q19319 2249 36 -
HGCNLLLIQPLDFENKSSYSLQLRLTS Q9VAF5 951 45 -
NTGTIRTTKVLDREETPWYNITVTASE CADE_HUMAN 436 156 -
LSGAVRIVQQLDFEKKQVYNLTVRAKD FATH_HUMAN 979 40 -

Motif 7 width=18
Element Seqn Id St Int Rpt
SNVTLQVFVLDENDNAPA Q9UN72 547 7 -
SNVTLQVFVLDENDNAPA O75288 547 7 -
SNVTLQVFVLDENDNAPA Q9Y5I3 547 7 -
SNVTLQVFVLDENDNAPA O75284 546 7 -
SNVTLQVFVLDENDNAPA Q9Y5H7 546 7 -
SNVTLQVFVLDENDNAPA O75279 546 7 -
SNVTLQVFVLDENDNAPA Q9Y5I1 546 7 -
SNVTLQVFVLDENDNAPA O75281 547 7 -
SNVTLQVFVLDENDNAPA Q9Y5H6 547 7 -
SNVTLQVFVLDENDNAPT O88689 547 7 -
SNVTLQVFVLDENDNAPA O75278 547 7 -
SNVTLQVFVLDENDNAPA Q9UN75 547 7 -
SNVTLQVFVLDENDNAPA O75283 547 7 -
SNVTLQVFVLDENDNAPA Q9UN73 547 7 -
SNLTLQVFVLDENDNAPA O75280 546 7 -
SNLTLQVFVLDENDNAPA Q9Y5I2 546 7 -
SNVSLSLFVLDQNDNAPE Q9Y5D1 544 7 -
SNVSLSLFVLDQNDNAPE Q9Y5G7 544 7 -
SNVTLQVFVLDENDNAPT O88690 547 7 -
SNVSLSLFVLDQNDNAPE Q9Y5D8 545 7 -
SNVSLSLFVLDQNDNAPE Q9Y5H2 545 7 -
SNVSLSLFVLDQNDNAPE Q9Y5D9 545 7 -
SNVSLRLFVLDQNDNAPE Q9Y5C9 544 7 -
SNVSLRLFVLDQNDNAPE Q9Y5G4 544 7 -
SNVSLNLFVLDQNDNAPE Q9Y5D4 544 7 -
SNVSLNLFVLDQNDNAPE Q9Y5H0 544 7 -
SNVSLSLFVLDQNDNTPE Q9Y5D2 544 7 -
SNVSLSLFVLDQNDNTPE Q9Y5G8 544 7 -
SRVPLYIKVLDVNDNAPE CAD6_RAT 470 118 -
SNVSLSLFVLDQNDNAPE Q9Y5E0 548 7 -
SNVSLSLFVLDQNDNAPE Q9Y5H3 548 7 -
SRVPLYIKVLDVNDNAPE CAD6_HUMAN 470 118 -
SNVSLSLFVLDQNDNAPE O60330 544 7 -
SNVSLSLFVLDQNDNAPE Q9Y5D7 544 7 -
SRVPVFIKVLDVNDNAPE Q90762 470 118 -
SNVSLSLFLLDQNDNAPE Q9Y5D6 544 7 -
SNVSLSLFLLDQNDNAPE Q9Y5H4 544 7 -
SRVPVAIKVLDVNDNAPE O54800 478 118 -
SRVPLYIKVLDVNDNAPE CAD6_MOUSE 470 118 -
SEALVRVLVLDANDNSPF Q9Y5E8 543 7 -
SEALVRVLVLDANDNSPF Q9Y5E2 543 7 -
SRVPVAIKVLDVNDNAPE Q9ULB2 478 118 -
SRVPVAIKVLDVNDNAPE CAD8_MOUSE 478 118 -
SEALVRVLVLDANDNSPF Q9Y5E4 542 7 -
SNMSLSLFVLDQNDNPPE Q9Y5D0 544 7 -
SNMSLSLFVLDQNDNPPE Q9Y5G6 544 7 -
SEALVRVLVLDANDNSPF Q9Y5E6 543 7 -
SNVSLSLFVLDQNDNAPE Q9Y5D5 544 7 -
SNVSLSLFVLDQNDNAPE Q9Y5H1 544 7 -
SRVPVAIKVLDVNDNAPE CAD8_HUMAN 471 118 -
ANVSLRVLVDDRNDNAPR Q9UN64 542 7 -
ANVSLRVLVDDRNDNAPR Q9UN71 542 7 -
ANVSLRVLVGDLNDNAPR Q9UN65 544 7 -
ANVSLRVLVGDLNDNAPR Q9Y5G2 544 7 -
SNMSLSLFVLDQNDNAPE O15039 544 7 -
SNMSLSLFVLDQNDNAPE Q9Y5G5 544 7 -
SEALVRVLVLDANDNSPF Q9NRJ8 543 7 -
SEALVRVLVLDANDNSPF Q9Y5E1 543 7 -
ANVSLRVLVGDRNDNAPR Q9Y5C5 544 7 -
ANVSLRVLVGDRNDNAPR Q9Y5F9 544 7 -
TRVPVYVRILDVNDNAPQ CADA_CHICK 471 118 -
ANVSLRVLVGDRNDNAPR Q9Y5C6 540 7 -
ANVSLRVLVGDRNDNAPR Q9Y5G0 540 7 -
SEALVRVLVLDANDNSPF Q9Y5E7 545 7 -
ANVSLRVLVGDLNDNAPR Q9Y5C8 540 7 -
ANVSLRVLVGDLNDNAPR Q9Y5G3 540 7 -
SEALVRVLVLDANDNSPF Q9Y5F1 543 7 -
SEALVRVLVLDTNDNSPF Q9Y5E5 542 7 -
TRVAVFVRILDANDNAPQ Q9Y6N8 471 118 -
SEALVRVLVLDANDNSPF Q9Y5F2 543 7 -
AKVPVAIRVLDVNDNAPK Q15066 470 118 -
SNVSLSLFVLDQNDNVPE Q9Y5D3 544 7 -
SNVSLSLFVLDQNDNVPE Q9Y5G9 544 7 -
SEALVRLLVLDANDNSPF Q9Y5E3 541 7 -
SEALVRVLVLDANDNSPF Q9Y5E9 543 7 -
ANVSLRVLVGDRNDNAPR Q9UN63 544 7 -
ANVSLRVLVGDRNDNAPR Q9Y5F8 544 7 -
AQVPVAIRVLDVNDNAPK CADB_HUMAN 470 118 -
TKVPVAIRVLDVNDNAPK CADB_MOUSE 470 118 -
REALVRVLVLDANDNSPF Q9UN67 543 7 -
AKVPVAIKVVDVNDNAPK O93319 470 118 -
GNATVNILIVDQNDNAPA Q9Z1B1 556 8 -
GSVAVTIKVLDVNDNAPE Q9Z0M3 476 118 -
SQTLVRMVVLDDNDNAPF Q63418 542 7 -
GGVPVTIKVLDVNDNAPT Q91838 469 118 -
TRVPVAIKVLDKNDNAPE O93264 470 118 -
SIVQVHIEVLDENDNAPE CAD5_HUMAN 461 119 -
GRGYVAITILDINDNAPE Q90763 464 118 -
GRGYVAITILDINDNAPE Q9ULB5 464 118 -
SNVSLSLFVLDQNDNVPE Q9Z1B0 540 7 -
SQVTVRVVVLDDNDNRPM Q9Y5F3 544 7 -
SNVSLSLFVLDQNDNAPE O08963 540 7 -
ANVSLRVLVDDRNDNAPL Q9Y5C7 544 7 -
ANVSLRVLVDDRNDNAPL Q9Y5G1 544 7 -
SEALVRVLVLDANDNSPF Q9UN66 544 7 -
SHIPVFIRILDINDHAPE Q9ULB4 470 118 -
GTGTLQIYLLDINDNAPQ CAD2_MOUSE 587 120 -
GTGTLQIYLLDINDNAPQ Q9Z1Y3 587 120 -
SEALVRVVVLDANDNSPF Q9Y5F0 543 7 -
GTGTLQIYLLDINDNAPQ CAD2_CHICK 593 121 -
GTGTLQIYLLDINDNAPQ CAD2_HUMAN 587 120 -
GTGTLLLVLLDVNDNAPI CAD1_MOUSE 579 118 -
STVTVRLFVLDLNDNAPA Q9Y5C3 547 7 -
STVTVRLFVLDLNDNAPA Q9Y5F7 547 7 -
SRASLRIRILDVNDNPPE Q63315 478 118 -
SRASLRIRILDVNDNPPE Q63561 478 118 -
SRASLRIRILDVNDNPPE Q9WTP5 478 118 -
GTGTLQIYLLDINDNAPY CADO_XENLA 588 120 -
GTGTLLLILSDVNDNAPI CAD1_HUMAN 577 118 -
GTGTLLLILSDVNDNAPI Q15855 573 118 -
TNISVNIFVTDRNDNAPQ O60622 549 7 -
TNISVNIFVTDRNDNAPQ Q9UN70 549 7 -
TNISVNIFVTDRNDNAPQ Q9Y5C4 549 7 -
SRASLRIRILDVNDNPPE Q9UJ99 481 118 -
GTGTLQIYLLDINDNAPY CADN_XENLA 588 120 -
GTGTLLLVLSDVNDNAPI Q9R0T4 581 118 -
SNATVRVTVLDVNDNAPV O14917 565 8 -
GTGTLQIYLIDINDNAPE CAD4_CHICK 594 120 -
SIVQVYIEVLDENDNPPE CAD5_MOUSE 459 120 -
SIVQVYIEVLDENDNPPE O35542 460 120 -
TNLSVNVFVTDLNDNAPT O13129 546 7 -
GTGTLQIYLLDINDNAPR Q90275 464 121 -
TNISVNIFVTDRNDNAPQ Q08192 548 7 -
TNLTILVDVQDVNDNPPV Q24292 965 7 -
SSGLVSVQVLDVNDNAPI O35161 562 8 -
ATATVSLFVMDENDNAPT O60245 724 7 -
ATATVSLFVMDENDNAPT O60246 724 7 -
ATATVSLFVMDENDNAPT O60247 677 7 -
ATATVSLFVMDENDNAPT O88185 724 7 -
SKVNILINVLDVNEFPPE CADC_HUMAN 471 118 -
SRATVHVRLLDRNDNPPV Q9R0M0 1006 215 -
GTGTLLLILSDVNDNAPI Q9UII7 596 118 -
STVTANVYVVDMNDHAPH Q9Y5F4 561 7 -
STVTANVYVVDMNDHAPH Q9Y5I4 561 7 -
SRATVHVRLVDQNDNSPV Q9NYQ7 1151 215 -
SSTSVSITVLDVNDNDPV Q9NYQ6 669 130 -
GTGTLQIYLIDINDNAPQ CAD4_MOUSE 594 120 -
GTGTLILHVLDVNDNGPV CADF_XENLA 592 117 -
GTGTLVLNLLDVNDNGPF CAD1_XENLA 571 117 -
ANTSLHVFVLDENDNAPA Q9Y5C2 546 7 -
ANTSLHVFVLDENDNAPA Q9Y5F6 546 7 -
ASASVTVTVLDVNDNRPE O88278 729 113 -
GTGTLLLLLQDVNDNGPT CAD1_CHICK 583 117 -
ATATVSLFVMDENDNAPS O57537 696 7 -
GTGTLLIQLIDINDNAPE P79883 603 120 -
ATVTINLFVVDRNDNYPV Q9Y5F5 537 7 -
ATVTINLFVVDRNDNYPV Q9Y5I5 537 7 -
SFIEVYIEVEDVNDNAPQ Q9WU10 1122 115 -
SSISVWVSLLDANDNAPE O55134 547 7 -
SVVPVVIHVIDENDNAPQ FAT_DROME 1135 7 -
GTGTLHITLEDVNDNVPS CADD_CHICK 567 120 -
GTGTLHITLEDVNDNVPS Q91353 567 120 -
GTGTLILHVLDINDNGPV CADB_XENLA 600 117 -
SSVDVEVNVLDINDNRPE Q9VEU1 1335 9 -
ATATIHINILDVNDNAPV Q9VGG5 1169 9 -
SSVSVWVSLLDANDNAPE Q9NPG4 547 7 -
DTTDVEIGVTDVNDNAPA Q9V5N8 989 7 -
AYVGVTINVLDENDNAPY Q08174 663 7 -
GTGTLLLTLIDVNDHGPV CAD3_HUMAN 530 117 -
STSRIVVSVLDINDNSPE Q9VW71 1278 220 -
TVIKVKVRVLDINDNPPR Q9VFH5 1611 426 -
SVVELQIEVLDVNDNAPE Q9VVG0 1152 10 -
ATASLSVEVADMNDNAPA Q9NRT8 446 7 -
GTGTLLITLEDVNDNAPF CADD_HUMAN 567 120 -
CTGTLGIILEDVNDNGPF DSC2_MOUSE 559 119 -
STTLIQVRVVDDNDNFPY O93508 546 7 -
CTGTLVVLLEDFNDHPPQ DSC1_MOUSE 559 120 -
GTGTLLITLEDINDNAPV Q9WTR5 567 120 -
CTGTLVVHLDDYNDHAPQ DSC1_HUMAN 559 120 -
STVPVRIHVSDVNDNKPA Q19482 1015 223 -
GTGTLLLTLTDINDHGPI CAD3_MOUSE 522 117 -
ATARVSVEVADVNDNAPA Q9NRT7 437 112 -
SSAKVTINVVDVNDNKPV Q9P2X5 655 7 -
NYTTVIIHVKDVNDNPPV O15943 1496 4 -
GNTTVIVTVLDEDDNAPR Q9TWY4 2124 7 -
GNTTVIVTVLDEDDNAPR YOG7_CAEEL 2128 7 -
TRVQLNLRIVDQNDNCPV O93509 549 7 -
CTGTLVVFLEDKNDHPPQ DSC1_BOVIN 558 121 -
STSRVVVCILDVNDNPPM O88277 1224 112 -
SNALVQVRVLDQNDHSPV Q9WVR2 591 7 -
SSALVQVRVLDQNDHAPV O95206 591 7 -
CTGTLGIILQDVNDNSPF DSC2_HUMAN 559 119 -
STSRVVVGILDVNDNPPI Q9NYQ8 1224 326 -
TFTNLTIFVSDINDNAPT O01912 1426 4 -
GFANVTIKVTDMNDNAPF Q9XWM6 1295 229 -
SVSEFHLILMDVNDNPPR Q12864 649 7 -
ATARVSVEVADVNDNAPA Q9NRU2 436 7 -
STGTVYVRVPDFNDNCPT DSG3_HUMAN 477 125 -
STADFHLVLTDVNDNPPR Q9R100 648 7 -
STAYFHLVLMDVNDNPPR CADL_RAT 648 7 -
AITTVTVDIGDVNDNAPA Q19319 2673 397 -
DTTSVEIIVQDENDNAPE Q9VAF5 987 9 -
SHVTVGIRVLDVNDNPPE CADE_HUMAN 470 7 -
SNVTLQVFVLDENDNAPA Q9Y5H8 547 7 -
SNVTLQVFVLDENDNAPA O15053 547 7 -
SNVTLQVFVLDENDNAPA Q9Y5H9 547 7 -
SNVTLQVFVLDENDNAPA O75287 547 7 -
SNVTLQVFVLDENDNAPA Q9UN74 547 7 -
SNVTLQVFVLDENDNAPA O75285 547 7 -
SFIEIYIEVEDVNDNAPQ FATH_HUMAN 1121 115 -
SNVTLQVFVLDENDNAPA O75286 547 7 -
SNVTLQVFVLDENDNAPA Q9Y5I0 547 7 -
SNVTLQVFVLDENDNAPA O75277 547 7 -
SNVTLQVFVLDENDNAPA Q9Y5H5 547 7 -
SNVTLQVFVLDENDNAPA O75282 547 7 -