SPRINT Home UMBER Home Contents Standard Search Advanced Search Relation Search

==SPRINT==> PRINTS View



  selected as


PR01698

Identifier
CYTOFMRPINTP  [View Relations]  [View Alignment]  
Accession
PR01698
No. of Motifs
12
Creation Date
14-JAN-2002
Title
Cytoplasmic fragile X mental retardation protein interacting protein signature
Database References
Literature References
1. SCHENKE, A., BARDONI, B., MORO, A., BAGNI, C. AND MANDEL, J.L.
A highly conserved protein family interacting with fragile X mental
retardation protein (FMRP) and displaying selective interactions with
FMRP-related proteins FXR1P and FXR2P.
PROC.NATL.ACAD.SCI.U.S.A. 98(15) 8844-8849 (2001).
 
2. SALLER, E., TOM, E., BRUNORI, M., OTTER, M., ESTREICHER, A., MACK, D.H.
AND IGGO, R.
Increased apoptosis induction by 121F mutant p53.
EMBO J. 18 4424-4437 (1999). 
 
3. KOSTER, F., SCHINKE, B., NIEMANN, S. AND HERMANS-BORGMEYER, I.
Identification of shyc, a novel gene expressed in the murine developing and
adult nervous system.
NEUROSCI.LETT. 252 69-71 (1998)

Documentation
Cytoplasmic fragile X mental retardation protein (FMRP) interacting protein
belongs to a highly conserved but, as yet, functionally uncharacterised
family. Absence of FMRP is responsible for pathologic manifestations in  
Fragile X Syndrome, the most frequent cause of inherited mental retardation
[1]. FMRP is an RNA-binding protein that may have a role in local protein
translation at neuronal dendrites and in dendritic spine maturation [1].
CYFIP1 and CYFIP2, which share a high level of sequence identity, have 
recently been identified as cytoplasmic FMRP interacting proteins [1].
CYFIP2 interacts with FMRP-related proteins FXR1P/2P, while CYFIP1 interacts
exclusively with FMRP. The FMRP-CYFIP interaction involves the domain of
FMRP that also mediates homo- and heteromerisation, suggesting competition
between the various interaction partners. CYFIP1 also interacts with the 
small GTPase Rac1 implicated in development and maintenance of neuronal
structures [1]. CYFIP1/2 are both present in synaptosomal extracts [1]. 
 
PIR121 (121F-specific p53 inducible RNA) is another functionally
uncharacterised member of this family. The PIR121 gene maps to human
chromosome 5q34, a region frequently translocated in acute myeloid leukaemia
but not known to be amplified or deleted in solid tumours. Interaction
between PIR121 and FMRP has been demonstrated, and hence PIR121 has also 
been termed CYFIP2 (Cytoplasmic FMRP Interacting Protein 2) [1,2]. 
 
Shyc (Selective HYbridizing Clone) is a cytoplasmic protein of unknown 
function, expressed in the developing and embryonic nervous system [3]. The
protein has also been designated CYFIP1 due to the high sequence identity
(98.7%) to its human orthologue. The CYFIP orthologues in Caenorhabditis
elegans and Drosophila melanogaster share about 51% and 67% sequence 
identity with the human proteins, respectively [1]. The high level of
conservation manifest throughout the entire CYFIP sequence between various
orthologues suggests a number of functionally/structurally important domains. 
 
CYTOFMRPINTP is a 12-element fingerprint that provides a signature for the
cytoplasmic fragile X mental retardation protein interacting protein family.
The fingerprint was derived from an initial alignment of 4 sequences: the
motifs were drawn from conserved regions spanning virtually the full 
alignment length. Two iterations on SPTR40_18f were required to reach
convergence, at which point a true set comprising 6 sequences was
identified. A single partial match was also found, Q9GM18, a hypothetical
protein from Macaca fascicularis that matches the N-terminal 3 motifs.
Summary Information
   6 codes involving 12 elements
0 codes involving 11 elements
0 codes involving 10 elements
0 codes involving 9 elements
0 codes involving 8 elements
0 codes involving 7 elements
0 codes involving 6 elements
0 codes involving 5 elements
0 codes involving 4 elements
1 codes involving 3 elements
0 codes involving 2 elements
Composite Feature Index
12666666666666
11000000000000
10000000000000
9000000000000
8000000000000
7000000000000
6000000000000
5000000000000
4000000000000
3000000000111
2000000000000
123456789101112
True Positives
O44518        O88558        Q9BSD9        Q9NTK4        
Q9UN29 Q9VF87
True Positive Partials
Codes involving 3 elements
Q9GM18
Sequence Titles
O44518      HYPOTHETICAL PROTEIN F56A11.1 - Caenorhabditis elegans. 
O88558 SHYC - Mus musculus (Mouse).
Q9BSD9 SIMILAR TO SELECTIVE HYBRIDIZING CLONE - Homo sapiens (Human).
Q9NTK4 HYPOTHETICAL 145.7 KDA PROTEIN - Homo sapiens (Human).
Q9UN29 P53 INDUCIBLE PROTEIN - Homo sapiens (Human).
Q9VF87 CG4931 PROTEIN (DRAC1-ASSOCIATED PROTEIN DSRA-1) - Drosophila melanogaster (Fruit fly).

Q9GM18 HYPOTHETICAL 42.8 KDA PROTEIN - Macaca fascicularis (Crab eating macaque) (Cynomolgus monkey).
Scan History
SPTR40_18f 2  100  NSINGLE    
Initial Motifs
Motif 1  width=18
Element Seqn Id St Int Rpt
TNFEDRNAFVTGIARYIE Q9BSD9 44 44 -
TNFEDRNAFVTGIARYIE Q9UN29 44 44 -
TNFEDRNAFVTGIARYIE O88558 44 44 -
TNFEDRNGFVTGIAKYIE Q9VF87 44 44 -

Motif 2 width=17
Element Seqn Id St Int Rpt
NEQPNRVEIYEKTVEVL Q9BSD9 99 37 -
NEQPNRVEIYEKTVEVL Q9UN29 99 37 -
NEQPNRVEIYEKTVEVL O88558 99 37 -
NEQPNRVEIYEKTVEVL Q9VF87 99 37 -

Motif 3 width=30
Element Seqn Id St Int Rpt
EVRRLCHAERRKDFVSEAYLITLGKFINMF Q9BSD9 139 23 -
EVKRLCHAERRKDFVSEAYLLTLGKFINMF Q9UN29 139 23 -
EVRRLCHAERRKDFVSEAYLITLGKFINMF O88558 139 23 -
EVKRLCHAEKRKDFVSEAYLLTLGKFINMF Q9VF87 139 23 -

Motif 4 width=16
Element Seqn Id St Int Rpt
KHMLLKVMGFGLYLMD Q9BSD9 260 91 -
KHMLLKVMGFGLYLMD Q9UN29 260 91 -
KHMLLKVMGFGLYLMD O88558 260 91 -
KHMLVKVMGFGLFLMD Q9VF87 260 91 -

Motif 5 width=19
Element Seqn Id St Int Rpt
AEEYERATRYNYTSEEKFA Q9BSD9 432 156 -
AEEYERATRYNYTSEEKFA Q9UN29 431 155 -
AEEYERATRYNYTTEEKFA O88558 432 156 -
AEEYERATRYNYTSEEKFA Q9VF87 427 151 -

Motif 6 width=24
Element Seqn Id St Int Rpt
VGPSSTQLYMVRTMLESLIADKSG Q9BSD9 552 101 -
VGPSSTQLYMVRTMLESLIADKSG Q9UN29 551 101 -
VGPSSTQLYMVRTMLESLIADKSG O88558 552 101 -
VGPSSTQLYMVRTMLESLIADKSG Q9VF87 547 101 -

Motif 7 width=19
Element Seqn Id St Int Rpt
CCDLSQLWFREFFLELTMG Q9BSD9 615 39 -
CCDLSQLWFREFFLELTMG Q9UN29 614 39 -
CCDLSQLWFREFFLELTMG O88558 615 39 -
CCDLSQLWYREFYLEMTMG Q9VF87 610 39 -

Motif 8 width=23
Element Seqn Id St Int Rpt
KQFLYDEIEAEVNLCFDQFVYKL Q9BSD9 684 50 -
KQFLYDEIEAEVNLCFDQFVYKL Q9UN29 683 50 -
KQFLYDEIEAEVNLCFDQFVYKL O88558 684 50 -
KQFLYDEVEAEVNLCFDQFVYKL Q9VF87 702 73 -

Motif 9 width=31
Element Seqn Id St Int Rpt
NRYETLLKQRHVQLLGRSIDLNRLITQRVSA Q9BSD9 744 37 -
NRYETLLKQRHVQLLGRSIDLNRLITQRISA Q9UN29 743 37 -
NRYETLLKQRHVQLLGRSIDLNRLITQRVSA O88558 744 37 -
NRYETLLKQRHVQLLGRSIDLNKLITQRINA Q9VF87 763 38 -

Motif 10 width=25
Element Seqn Id St Int Rpt
LLTKERLCCGLSMFEVILTRIRSFL Q9BSD9 1080 305 -
LLTKERLCCGLSMFEVILTRIRSYL Q9UN29 1079 305 -
LLTKERLCCGLSMFEVILTRIRTFL O88558 1080 305 -
LLTRERLCCGLSIFEVILNRVKSYL Q9VF87 1102 308 -

Motif 11 width=17
Element Seqn Id St Int Rpt
EFHRLWSAMQFVYCIPV Q9BSD9 1126 21 -
EFHRLWSAMQFVYCIPV Q9UN29 1125 21 -
EFHRLWSAMQFVYCIPV O88558 1126 21 -
EFHRLWSALQFVYCIPV Q9VF87 1148 21 -

Motif 12 width=15
Element Seqn Id St Int Rpt
LKKMVERIRKFQILN Q9BSD9 1201 58 -
LKKMADRIRKYQILN Q9UN29 1200 58 -
LKKMVERIRKFQILN O88558 1201 58 -
LKRMVDRIRRFQVLN Q9VF87 1223 58 -
Final Motifs
Motif 1  width=18
Element Seqn Id St Int Rpt
TNFEDRNAFVTGIARYIE Q9BSD9 44 44 -
TNFEDRNAFVTGIARYIE Q9NTK4 44 44 -
TNFEDRNAFVTGIARYIE Q9UN29 44 44 -
TNFEDRNAFVTGIARYIE O88558 44 44 -
TNFEDRNGFVTGIAKYIE Q9VF87 44 44 -
TNFEDRSAFVTGIAKYSE O44518 44 44 -

Motif 2 width=17
Element Seqn Id St Int Rpt
NEQPNRVEIYEKTVEVL Q9BSD9 99 37 -
NEQPNRVEIYEKTVEVL Q9NTK4 99 37 -
NEQPNRVEIYEKTVEVL Q9UN29 99 37 -
NEQPNRVEIYEKTVEVL O88558 99 37 -
NEQPNRVEIYEKTVEVL Q9VF87 99 37 -
NDQPNRTEINEMVVEVL O44518 99 37 -

Motif 3 width=30
Element Seqn Id St Int Rpt
EVRRLCHAERRKDFVSEAYLITLGKFINMF Q9BSD9 139 23 -
EVKRLCHAERRKDFVSEAYLLTLGKFINMF Q9NTK4 139 23 -
EVKRLCHAERRKDFVSEAYLLTLGKFINMF Q9UN29 139 23 -
EVRRLCHAERRKDFVSEAYLITLGKFINMF O88558 139 23 -
EVKRLCHAEKRKDFVSEAYLLTLGKFINMF Q9VF87 139 23 -
EVRRLCHSEKRRDFVSEAYLLTLGRFINMF O44518 238 122 -

Motif 4 width=16
Element Seqn Id St Int Rpt
KHMLLKVMGFGLYLMD Q9BSD9 260 91 -
KHMLLKVMGFGLYLMD Q9NTK4 260 91 -
KHMLLKVMGFGLYLMD Q9UN29 260 91 -
KHMLLKVMGFGLYLMD O88558 260 91 -
KHMLVKVMGFGLFLMD Q9VF87 260 91 -
KHMFVKVIAFSLFLMD O44518 416 148 -

Motif 5 width=19
Element Seqn Id St Int Rpt
AEEYERATRYNYTSEEKFA Q9BSD9 432 156 -
AEEYERATRYNYTSEEKFA Q9NTK4 431 155 -
AEEYERATRYNYTSEEKFA Q9UN29 431 155 -
AEEYERATRYNYTTEEKFA O88558 432 156 -
AEEYERATRYNYTSEEKFA Q9VF87 427 151 -
AEEYERATRYNYSPAEKTA O44518 582 150 -

Motif 6 width=24
Element Seqn Id St Int Rpt
VGPSSTQLYMVRTMLESLIADKSG Q9BSD9 552 101 -
VGPSSTQLYMVRTMLESLIADKSG Q9NTK4 551 101 -
VGPSSTQLYMVRTMLESLIADKSG Q9UN29 551 101 -
VGPSSTQLYMVRTMLESLIADKSG O88558 552 101 -
VGPSSTQLYMVRTMLESLIADKSG Q9VF87 547 101 -
AAPGSTQLYMARTQLESLISDKLC O44518 709 108 -

Motif 7 width=19
Element Seqn Id St Int Rpt
CCDLSQLWFREFFLELTMG Q9BSD9 615 39 -
CCDLSQLWFREFFLELTMG Q9NTK4 614 39 -
CCDLSQLWFREFFLELTMG Q9UN29 614 39 -
CCDLSQLWFREFFLELTMG O88558 615 39 -
CCDLSQLWYREFYLEMTMG Q9VF87 610 39 -
AGELSQLWFREFYLEMTMG O44518 773 40 -

Motif 8 width=23
Element Seqn Id St Int Rpt
KQFLYDEIEAEVNLCFDQFVYKL Q9BSD9 684 50 -
KQFLYDEIEAEVNLCFDQFVYKL Q9NTK4 683 50 -
KQFLYDEIEAEVNLCFDQFVYKL Q9UN29 683 50 -
KQFLYDEIEAEVNLCFDQFVYKL O88558 684 50 -
KQFLYDEVEAEVNLCFDQFVYKL Q9VF87 702 73 -
KQFLYDEVEAEVNLCFDQFVYKL O44518 842 50 -

Motif 9 width=31
Element Seqn Id St Int Rpt
NRYETLLKQRHVQLLGRSIDLNRLITQRVSA Q9BSD9 744 37 -
NRYETLLKQRHVQLLGRSIDLNRLITQRISA Q9NTK4 743 37 -
NRYETLLKQRHVQLLGRSIDLNRLITQRISA Q9UN29 743 37 -
NRYETLLKQRHVQLLGRSIDLNRLITQRVSA O88558 744 37 -
NRYETLLKQRHVQLLGRSIDLNKLITQRINA Q9VF87 763 38 -
ARFESLLQQRHVQLLGRSVDLNRVVSQRVNM O44518 902 37 -

Motif 10 width=25
Element Seqn Id St Int Rpt
LLTKERLCCGLSMFEVILTRIRSFL Q9BSD9 1080 305 -
LLTKERLCCGLSMFEVILTRIRSYL Q9NTK4 1079 305 -
LLTKERLCCGLSMFEVILTRIRSYL Q9UN29 1079 305 -
LLTKERLCCGLSMFEVILTRIRTFL O88558 1080 305 -
LLTRERLCCGLSIFEVILNRVKSYL Q9VF87 1102 308 -
LMTKERLCCGLNAFENFLVRIKQML O44518 1240 307 -

Motif 11 width=17
Element Seqn Id St Int Rpt
EFHRLWSAMQFVYCIPV Q9BSD9 1126 21 -
EFHRLWSAMQFVYCIPV Q9NTK4 1125 21 -
EFHRLWSAMQFVYCIPV Q9UN29 1125 21 -
EFHRLWSAMQFVYCIPV O88558 1126 21 -
EFHRLWSALQFVYCIPV Q9VF87 1148 21 -
EWYRVYSALQFFLCQPT O44518 1287 22 -

Motif 12 width=15
Element Seqn Id St Int Rpt
LKKMVERIRKFQILN Q9BSD9 1201 58 -
LKKMADRIRKYQILN Q9NTK4 1200 58 -
LKKMADRIRKYQILN Q9UN29 1200 58 -
LKKMVERIRKFQILN O88558 1201 58 -
LKRMVDRIRRFQVLN Q9VF87 1223 58 -
LAKMVERIRRFQLLN O44518 1363 59 -