SPRINT Home UMBER Home Contents Standard Search Advanced Search Relation Search

==SPRINT==> PRINTS View



  selected as


PR00776

Identifier
HEMOGLOBNASE  [View Relations]  [View Alignment]  
Accession
PR00776
No. of Motifs
5
Creation Date
21-JUN-1997  (UPDATE 07-JUN-1999)
Title
Hemoglobinase (C13) cysteine protease signature
Database References

INTERPRO; IPR001096
Literature References
1. RAWLINGS, N.D. AND BARRETT, A.J.
Families of cysteine peptidases.
METHODS ENZYMOL. 244 461-486 (1994).
 
2. DAVIS, A.H., NANDURI, J. AND WATSON, D.C.
Cloning and gene expression of Schistosoma mansoni protease.
J.BIOL.CHEM. 262 12851-12855 (1987).
 
3. GOTZ, B. AND KLINKERT, M.Q.
Expression and partial characterization of a cathepsin B-like enzyme (Sm31)
and a proposed `haemoglobinase' (Sm32) from Schistosoma mansoni.
BIOCHEM.J. 290 801-806 (1993).

Documentation
Cysteine protease activity is dependent on an active dyad of cysteine and
histidine, the order and spacing of these residues varying in the 20 or so
known families. Families C1, C2 and C10 are loosely termed papain-like. 
Nearly half of all cysteine proteases are found exclusively in viruses [1].
 
The blood fluke parasite Schistosoma mansoni has two cysteine proteases in 
its digestive tract, one a cathepsin B-like protease, the other termed
hemoglobinase [1,2]. The latter has been hard to purify, free of cathepsin
B, and expressed forms in E.coli prove to be inactive, suggesting that
hemoglobinase may act in association with cathepsin B [1,3]. Plant vacuolar
processing enzyme and legumain from legumes [1] have been shown to have
sequence and functional similarity to hemoglobinase. The catalytic residues
of the family are currently unknown, but sequence alignments reveal one
totally conserved cysteine and two totally conserved histidines.
 
HEMOGLOBNASE is a 5-element fingerprint that provides a signature for the
hemoglobinase (C13) family of cysteine proteases. The fingerprint was
derived from an initial alignment of 8 sequences: the motifs were drawn from
conserved regions spanning the N-terminal portion of the alignment, motifs
1 and 4 containing the totally conserved histidines. Two iterations on
OWL29.3 were required to reach convergence, at which point a true set
comprising 15 sequences was identified. A single partial match was also
found, CET28H103, an expressed protein from C.elegans cosmid T28H10 that
matches strongly with motifs 1-3 and appears to be a hemoglobinase-like
protein fragment.
 
An update on SPTR37_9f identified a true set of 23 sequences.
Summary Information
23 codes involving  5 elements
0 codes involving 4 elements
0 codes involving 3 elements
0 codes involving 2 elements
Composite Feature Index
52323232323
400000
300000
200000
12345
True Positives
GPI8_YEAST    HGLB_SCHJA    HGLB_SCHMA    LEGU_CANEN    
LEGU_HUMAN O14822 O24325 O24326
O24539 O46047 O64674 O82102
O82806 O89017 Q17945 Q39044
Q39119 VPEA_ARATH VPE_CITSI VPE_RICCO
VPE_SOYBN VPE_VICSA YJ96_CAEEL
Sequence Titles
GPI8_YEAST  GPI-ANCHOR TRANSMIDASE (EC 3.-.-.-) - SACCHAROMYCES CEREVISIAE (BAKER'S YEAST). 
HGLB_SCHJA HEMOGLOBINASE PRECURSOR (EC 3.4.22.-) (ANTIGEN SJ32) - SCHISTOSOMA JAPONICUM (BLOOD FLUKE).
HGLB_SCHMA HEMOGLOBINASE PRECURSOR (EC 3.4.22.-) (ANTIGEN SM32) - SCHISTOSOMA MANSONI (BLOOD FLUKE).
LEGU_CANEN LEGUMAIN PRECURSOR (EC 3.4.22.34) (ASPARAGINYL ENDOPEPTIDASE) - CANAVALIA ENSIFORMIS (JACK BEAN) (HORSE BEAN).
LEGU_HUMAN LEGUMAIN PRECURSOR (EC 3.4.22.34) (ASPARAGINYL ENDOPEPTIDASE) - HOMO SAPIENS (HUMAN).
O14822 GPI TRANSAMIDASE - HOMO SAPIENS (HUMAN).
O24325 VACUOLAR PROCESSING ENZYME PRECURSOR (EC 3.4.22.-) (VPE) (LEGUMAIN-LIKE PROTEINASE) (LLP1) - PHASEOLUS VULGARIS (KIDNEY BEAN) (FRENCH BEAN).
O24326 LEGUMAIN-LIKE PROTEINASE PRECURSOR (EC 3.4.22.34) (BEAN ENDOPEPTIDASE) (VICILIN PEPTIDOHYDROLASE) (PHASEOLIN) - PHASEOLUS VULGARIS (KIDNEY BEAN) (FRENCH BEAN).
O24539 CYSTEINE PROTEINASE PRECURSOR - VICIA NARBONENSIS.
O46047 EG:133E12.3 PROTEIN - DROSOPHILA MELANOGASTER (FRUIT FLY).
O64674 F22O13.26 - ARABIDOPSIS THALIANA (MOUSE-EAR CRESS).
O82102 CYSTEINE PROTEINASE PRECURSOR - VICIA SATIVA (SPRING VETCH) (TARE).
O82806 ALPHA-VACUOLAR PROCESSING ENZYME - ARABIDOPSIS THALIANA (MOUSE-EAR CRESS).
O89017 LEGUMAIN PRECURSOR (EC 3.4.22.34) (BEAN ENDOPEPTIDASE) (VICILIN PEPTIDOHYDROLASE) (PHASEOLIN) - MUS MUSCULUS (MOUSE).
Q17945 T28H10.3 PROTEIN - CAENORHABDITIS ELEGANS.
Q39044 BETA-VPE - ARABIDOPSIS THALIANA (MOUSE-EAR CRESS).
Q39119 GAMMA-VPE - ARABIDOPSIS THALIANA (MOUSE-EAR CRESS).
VPEA_ARATH VACUOLAR PROCESSING ENZYME, ALPHA-ISOZYME PRECURSOR (EC 3.4.22.-) (ALPHA-VPE) - ARABIDOPSIS THALIANA (MOUSE-EAR CRESS).
VPE_CITSI VACUOLAR PROCESSING ENZYME PRECURSOR (EC 3.4.22.-) (VPE) - CITRUS SINENSIS (SWEET ORANGE).
VPE_RICCO VACUOLAR PROCESSING ENZYME PRECURSOR (EC 3.4.22.-) (VPE) - RICINUS COMMUNIS (CASTOR BEAN).
VPE_SOYBN VACUOLAR PROCESSING ENZYME PRECURSOR (EC 3.4.22.-) (VPE) - GLYCINE MAX (SOYBEAN).
VPE_VICSA VACUOLAR PROCESSING ENZYME PRECURSOR (EC 3.4.22.-) (VPE) (PROTEINASE B) - VICIA SATIVA (SPRING VETCH) (TARE).
YJ96_CAEEL HYPOTHETICAL 36.9 KD PROTEIN T05E11.6 IN CHROMOSOME IV - CAENORHABDITIS ELEGANS.
Scan History
OWL29_3    2  100  NSINGLE    
SPTR37_9f 2 24 NSINGLE
Initial Motifs
Motif 1  width=25
Element Seqn Id St Int Rpt
WAILLAGSNGYWNYRHQSDVCHAYQ VPE_VICSA 57 57 -
WAVLVAGSNGFENYRHQADVCHAYH HGLB_SCHJA 32 32 -
WAVLVAGSNGYPNYRHQADVCHAYH HGLB_SCHMA 38 38 -
WAVLVCTSKFWFNYRHVSNVLALYH YJ96_CAEEL 42 42 -
WAVLVSTSRFWFNYRHMANVLSMYR YD82_YEAST 39 39 -
WAVLVAGSSGYWNYRHQADVCHAYQ VPEA_ARATH 45 45 -
WAVLVAGSNGYGNYRHQADVCHAYQ LEGU_CANEN 41 41 -
WAVLVAGSMGFGNYRHQADVCHAYQ VPE_RICCO 63 63 -

Motif 2 width=30
Element Seqn Id St Int Rpt
LLRKGGSKEENIIVFMYDDIASNEENPRPG VPE_VICSA 82 0 -
VLRSKGIKPEHIITMMYDDIAYNLMNPFPG HGLB_SCHMA 63 0 -
TVKRLGIPDSQIILMLSDDVACNSRNLFPG YD82_YEAST 64 0 -
SIKRLGIPDSNIIMMLAEDVPCNSRNPRPG YJ96_CAEEL 67 0 -
RLKKGGVKEENIVVLMYDDIAENEENPRPG VPEA_ARATH 70 0 -
LLIKGGVKEENIVVFMYDDIAYNAMNPRPG LEGU_CANEN 66 0 -
LLRKGGLKEENIIVFMYDDIAKNELNPRPG VPE_RICCO 88 0 -
VLLSKGVKPEHIITFMYDDIAHNKENPFPG HGLB_SCHJA 57 0 -

Motif 3 width=16
Element Seqn Id St Int Rpt
DYTGEDVTPENLYAVI LEGU_CANEN 113 17 -
DYRGYEVTVENFIRLL YD82_YEAST 113 19 -
DYTGDEVNVDNLLAVI VPEA_ARATH 117 17 -
DYTGEHVTAKNLYAVL VPE_RICCO 135 17 -
DYTGAEVHADNFYAAL VPE_VICSA 129 17 -
DYKGKKVNPKTFLQVL HGLB_SCHJA 104 17 -
DYRGKNVNSKTFLKVL HGLB_SCHMA 110 17 -
DYRGEEVTVESFIRVL YJ96_CAEEL 115 18 -

Motif 4 width=20
Element Seqn Id St Int Rpt
KRLLTDHQSNVLIYLTGHGG YJ96_CAEEL 142 11 -
KVVDSGPNDHIFIYYSDHGG VPEA_ARATH 145 12 -
KVINSNPEDRIFIFYSDHGG LEGU_CANEN 141 12 -
KVVDSKPNDRIFLYYSDHGG VPE_RICCO 163 12 -
KRLLTDENSNIFIYMTGHGG YD82_YEAST 140 11 -
KVVDSGPNDHIFVYYTDHGG VPE_VICSA 157 12 -
KVLKSGKNDDVFIYFTDHGA HGLB_SCHJA 128 8 -
KVLKSGKNDDVFIYFTDHGA HGLB_SCHMA 134 8 -

Motif 5 width=17
Element Seqn Id St Int Rpt
YSKLVIYVEACESGSMF HGLB_SCHJA 176 28 -
YHEMLVIADSCRSASMY YJ96_CAEEL 191 29 -
YKSLVFYLEACESGSIF VPEA_ARATH 194 29 -
YNEIFFMIDTCQANTMY YD82_YEAST 189 29 -
YKEMVIYIEACESGSIF LEGU_CANEN 190 29 -
YKKMVIYVEACESGSIF VPE_RICCO 212 29 -
YKSLVFYLEACESGSIF VPE_VICSA 206 29 -
YSKLVIYIEANESGSMF HGLB_SCHMA 182 28 -
Final Motifs
Motif 1  width=25
Element Seqn Id St Int Rpt
WAVLVAGSSGYWNYRHQADVCHAYQ O82806 45 45 -
WAVLVAGSSGYWNYRHQADVCHAYQ VPEA_ARATH 45 45 -
WAVLVAGSNGYGNYRHQADVCHAYQ O24326 59 59 -
WAVLVAGSNGYGNYRHQADVCHAYQ LEGU_CANEN 41 41 -
WAVLVAGSMGFGNYRHQADVCHAYQ VPE_RICCO 63 63 -
WAVLVAGSNGYGNYRHQADVCHAYQ O24539 54 54 -
WAVLVAGSNGYGNYRHQADVCHAYQ VPE_SOYBN 61 61 -
WAVLVAGSSGYWNYRHQADICHAYQ Q39119 56 56 -
WAVLLAGSNGFWNYRHQADICHAYQ VPE_CITSI 61 61 -
WAVLVAGSSGYGNYRHQADVCHAYQ Q39044 52 52 -
WAVLVAGSNGYGNYRHQADVCHAYQ O82102 68 68 -
WAILLAGSNGYWNYRHQSDVCHAYQ VPE_VICSA 57 57 -
WAILFAGSSGYWNYRHQADICHAYQ O24325 50 50 -
WVVIVAGSNGWYNYRHQADACHAYQ O89017 32 32 -
WVVIVAGSNGWYNYRHQADACHAYQ LEGU_HUMAN 30 30 -
WAVLVAGSNGFENYRHQADVCHAYH HGLB_SCHJA 32 32 -
WAVLVAGSNGYPNYRHQADVCHAYH HGLB_SCHMA 38 38 -
FVVLVAGSNGWYNYRHQADVAHAYH Q17945 44 44 -
WAVLVDASRFWFNYRHVANVLSIYR O46047 47 47 -
WAVLVCTSRFWFNYRHVANTLSVYR O14822 46 46 -
WAVLVSTSRFWFNYRHMANVLSMYR GPI8_YEAST 39 39 -
WAVLVCTSKFWFNYRHVSNVLALYH YJ96_CAEEL 42 42 -
WAVLVCTSRFCSLHSLVLTFIFSLL O64674 28 28 -

Motif 2 width=30
Element Seqn Id St Int Rpt
LLKKGGVKEENIVVFMYDDIAKNEENPRPG O82806 70 0 -
RLKKGGVKEENIVVLMYDDIAENEENPRPG VPEA_ARATH 70 0 -
LLIKGGVKEENIVVFMYDDIATHELNPRPG O24326 84 0 -
LLIKGGVKEENIVVFMYDDIAYNAMNPRPG LEGU_CANEN 66 0 -
LLRKGGLKEENIIVFMYDDIAKNELNPRPG VPE_RICCO 88 0 -
LLIKGGVKEENIVVFMYDDIAYNEMNPRPG O24539 79 0 -
LLIKGGLKEENIVVFMYDDIATNELNPRHG VPE_SOYBN 86 0 -
LLRKGGLKEENIVVFMYDDIANNYENPRPG Q39119 81 0 -
LLRKGGLKDENIIVFMYDDIAFNEENPRPG VPE_CITSI 86 0 -
ILRKGGLKEENIVVLMYDDIANHPLNPRPG Q39044 77 0 -
LLIKGGVKEENIVVFMYDDIAYSEFNPRPG O82102 93 0 -
LLRKGGSKEENIIVFMYDDIASNEENPRPG VPE_VICSA 82 0 -
LLRKGGLKDENIIVFMYDDIAFNSENPRRG O24325 75 0 -
IIHRNGIPDEQIIVMMYDDIANSEENPTPG O89017 57 0 -
IIHRNGIPDEQIVVMMYDDIAYSEDNPTPG LEGU_HUMAN 55 0 -
VLLSKGVKPEHIITFMYDDIAHNKENPFPG HGLB_SCHJA 57 0 -
VLRSKGIKPEHIITMMYDDIAYNLMNPFPG HGLB_SCHMA 63 0 -
TLRNHGIPEENIITMMYDDVANNPLNPYKG Q17945 69 0 -
SVKRLGIPDSQIILMIADDMACNARNPRPG O46047 72 0 -
SVKRLGIPDSHIVLMLADDMACNPRNPKPA O14822 71 0 -
TVKRLGIPDSQIILMLSDDVACNSRNLFPG GPI8_YEAST 64 0 -
SIKRLGIPDSNIIMMLAEDVPCNSRNPRPG YJ96_CAEEL 67 0 -
TVKRLGIPDERIILMLADDMACNARNEYPA O64674 57 4 -

Motif 3 width=16
Element Seqn Id St Int Rpt
DYTGDEVNVDNLLAVI O82806 117 17 -
DYTGDEVNVDNLLAVI VPEA_ARATH 117 17 -
DYTGESVTSHNFFAVL O24326 131 17 -
DYTGEDVTPENLYAVI LEGU_CANEN 113 17 -
DYTGEHVTAKNLYAVL VPE_RICCO 135 17 -
DYNGDFVTAENFYAVI O24539 126 17 -
DYTGDNVTTENLFAVI VPE_SOYBN 133 17 -
DYTGDDVNVDNLFAVI Q39119 128 17 -
DYTGEDVTVEKFFAVV VPE_CITSI 133 17 -
DYTGSSVTAANFYAVL Q39044 124 17 -
DYTGDFVTADNLYAVI O82102 140 17 -
DYTGAEVHADNFYAAL VPE_VICSA 129 17 -
DYTGEDVTAHNFYAAL O24325 122 17 -
DYTGEDVTPENFLAVL O89017 104 17 -
DYTGEDVTPQNFLAVL LEGU_HUMAN 102 17 -
DYKGKKVNPKTFLQVL HGLB_SCHJA 104 17 -
DYRGKNVNSKTFLKVL HGLB_SCHMA 110 17 -
DYKGASVTPENFLNVL Q17945 116 17 -
DYRGYEVTVENFVRLL O46047 121 19 -
DYRSYEVTVENFLRVL O14822 120 19 -
DYRGYEVTVENFIRLL GPI8_YEAST 113 19 -
DYRGEEVTVESFIRVL YJ96_CAEEL 115 18 -
DYRGYEVTVENFLRVL O64674 106 19 -

Motif 4 width=20
Element Seqn Id St Int Rpt
KVVDSGPNDHIFIYYSDHGG O82806 145 12 -
KVVDSGPNDHIFIYYSDHGG VPEA_ARATH 145 12 -
KVINSKPEDRIFVYYSDHGG O24326 159 12 -
KVINSNPEDRIFIFYSDHGG LEGU_CANEN 141 12 -
KVVDSKPNDRIFLYYSDHGG VPE_RICCO 163 12 -
KVINSKAEDRIFIYCSDHGG O24539 154 12 -
KVINSKPEDRIFIYYSDHGG VPE_SOYBN 161 12 -
KVVDSGPNDHIFIFYSDHGG Q39119 156 12 -
KVVDSGPNDHIFIFYSDHGG VPE_CITSI 161 12 -
KVIASKPNDHIFVYYADHGG Q39044 152 12 -
KVINSKAEDRIFIYYSDHGG O82102 168 12 -
KVVDSGPNDHIFVYYTDHGG VPE_VICSA 157 12 -
KVVNSGPNDHIFIFYSDHGG O24325 150 12 -
KVLKSGPRDHVFIYFTDHGA O89017 133 13 -
KVLKSGPQDHVFIYFTDHGS LEGU_HUMAN 131 13 -
KVLKSGKNDDVFIYFTDHGA HGLB_SCHJA 128 8 -
KVLKSGKNDDVFIYFTDHGA HGLB_SCHMA 134 8 -
RVLETNDNDRVFVYFTDHGA Q17945 144 12 -
KKLLSDAGSNVLIYLTGHGG O46047 148 11 -
KRLLSDDRSNILIYMTGHGG O14822 147 11 -
KRLLTDENSNIFIYMTGHGG GPI8_YEAST 140 11 -
KRLLTDHQSNVLIYLTGHGG YJ96_CAEEL 142 11 -
KRLLSDEGSHILLYMTGHGG O64674 133 11 -

Motif 5 width=17
Element Seqn Id St Int Rpt
YKSLVFYLEACESGSIF O82806 194 29 -
YKSLVFYLEACESGSIF VPEA_ARATH 194 29 -
YKEMVIYVEACESGSIF O24326 208 29 -
YKEMVIYIEACESGSIF LEGU_CANEN 190 29 -
YKKMVIYVEACESGSIF VPE_RICCO 212 29 -
YKKMVIYVEACESGSIF O24539 203 29 -
YKEMVIYVEACESGSVF VPE_SOYBN 210 29 -
YKSLVFYLEACESGSIF Q39119 205 29 -
YKSLVFYLEACESGSIF VPE_CITSI 210 29 -
YKEMVIYVEACESGSIF Q39044 201 29 -
YQQMVIYVEACESGSVF O82102 217 29 -
YKSLVFYLEACESGSIF VPE_VICSA 206 29 -
YKNLVFYLEACESGSIF O24325 199 29 -
YQKMVFYIEACESGSMM O89017 181 28 -
YRKMVFYIEACESGSMM LEGU_HUMAN 179 28 -
YSKLVIYVEACESGSMF HGLB_SCHJA 176 28 -
YSKLVIYIEANESGSMF HGLB_SCHMA 182 28 -
YSQLTFYLEACESGSMF Q17945 192 28 -
YNELFFMVDTCQAASLY O46047 197 29 -
YNELLFIIDTCQGASMY O14822 196 29 -
YNEIFFMIDTCQANTMY GPI8_YEAST 189 29 -
YHEMLVIADSCRSASMY YJ96_CAEEL 191 29 -
FKELMIMVDTCQAATLF O64674 182 29 -