SPRINT Home UMBER Home Contents Standard Search Advanced Search Relation Search

==SPRINT==> PRINTS View



  selected as


PR00130

Identifier
DNASEI  [View Relations]  [View Alignment]  
Accession
PR00130
No. of Motifs
8
Creation Date
22-FEB-1994  (UPDATE 07-JUN-1999)
Title
DNase I signature
Database References

PROSITE; PS00918 DNASE_I_1; PS00919 DNASE_I_2
BLOCKS; BL00918
PFAM; PF01181 DNase_I
INTERPRO; IPR001582
PDB; 3DNI
SCOP; 3DNI
CATH; 3DNI
Literature References
1. PAUDEL, H.K. AND LIAO, T.H.
Purification, characterization, and the complete amino acid sequence of
porcine pancreatic deoxyribonuclease.
J.BIOL.CHEM. 261(34) 16006-16011 (1986).
 
2. KABSCH, W., MANNHERTZ, H.G., SUCK, D., PAI, E.F. AND HOLMES, K.C.
Atomic structure of the actin - DNase I complex.
NATURE 347 37-44 (1990).
 
3. SHAK, S., CAPON, D.J., HELLMISS, R., MARSTERS, S.A. AND BAKER, C.L.
Recombinant human DNase I reduces the viscosity of cystic fibrosis sputum.
PROC.NATL.ACAD.SCI.U.S.A. 87(23) 9188-9192 (1990).

Documentation
Deoxyribonuclease I (DNase I) is a glycoprotein that causes the cleavage
of the 3'-phosphorous-oxygen bond of the sugar-phosphate DNA backbone, 
releasing 5'-phosphoryl nucleotides [1]. The protein is usually secreted
by cells (but can be located in the nucleus), causing cell death by
apoptosis. DNase I forms a 1:1 complex with G-actin, resulting in the
inhibition of DNase activity and loss of the ability of G-actin to
polymerise into fibres [2]. DNase I has been used in the treatment of lung
problems in patients with cystic fibrosis: here it acts by degrading DNA
found in purulent lung secretions, reducing their viscosity and making it
easier for the patient to breathe [3].
 
DNASEI is an 8-element fingerprint that provides a signature for DNASE I
proteins. The fingerprint was derived from an initial alignment of 3
sequences: the motifs were drawn from conserved regions spanning virtually
the full alignment length, motifs 3 and 4 including the regions encoded by
PROSITE patterns DNASE_I_1 (PS00918) and DNASE_I_2 (PS00919), the latter
containing the catalytically active histidine. Two iterations on OWL22.1
were required to reach convergence, at which point a true set comprising 5
sequences was identified. Two partial matches were also found, NRL_1ATND1
and NRL_1ATND2, both of which are DNase I fragments. 
 
An update on SPTR37_9f identified a true set of 8 sequences, and 6
partial matches.
Summary Information
   8 codes involving  8 elements
5 codes involving 7 elements
1 codes involving 6 elements
0 codes involving 5 elements
0 codes involving 4 elements
0 codes involving 3 elements
0 codes involving 2 elements
Composite Feature Index
888888888
752555535
610011111
500000000
400000000
300000000
200000000
12345678
True Positives
DHP1_HUMAN    DRN1_BOVIN    DRN1_HUMAN    DRN1_MOUSE    
DRN1_PIG DRN1_RABIT DRN1_RAT DRN1_SHEEP
True Positive Partials
Codes involving 7 elements
DHP2_HUMAN DHP2_MOUSE DRNL_HUMAN O42446
O75803
Codes involving 6 elements
O89107
Sequence Titles
DHP1_HUMAN  DNASE I HOMOLOGOUS PROTEIN DHP1 PRECURSOR (EC 3.1.21.-) - HOMO SAPIENS (HUMAN). 
DRN1_BOVIN DEOXYRIBONUCLEASE I PRECURSOR (EC 3.1.21.1) (DNASE I) - BOS TAURUS (BOVINE).
DRN1_HUMAN DEOXYRIBONUCLEASE I PRECURSOR (EC 3.1.21.1) (DNASE I) (DORNASE ALFA) - HOMO SAPIENS (HUMAN).
DRN1_MOUSE DEOXYRIBONUCLEASE I PRECURSOR (EC 3.1.21.1) (DNASE I) - MUS MUSCULUS (MOUSE).
DRN1_PIG DEOXYRIBONUCLEASE I (EC 3.1.21.1) (DNASE I) - SUS SCROFA (PIG).
DRN1_RABIT DEOXYRIBONUCLEASE I PRECURSOR (EC 3.1.21.1) (DNASE I) - ORYCTOLAGUS CUNICULUS (RABBIT).
DRN1_RAT DEOXYRIBONUCLEASE I PRECURSOR (EC 3.1.21.1) (DNASE I) - RATTUS NORVEGICUS (RAT).
DRN1_SHEEP DEOXYRIBONUCLEASE I (EC 3.1.21.1) (DNASE I) - OVIS ARIES (SHEEP).

DHP2_HUMAN DNASE I HOMOLOGOUS PROTEIN DHP2 PRECURSOR (EC 3.1.21.-) (LIVER AND SPLEEN DNASE) (LS-DNASE) (LSD) - HOMO SAPIENS (HUMAN).
DHP2_MOUSE DNASE I HOMOLOGOUS PROTEIN DHP2 PRECURSOR (EC 3.1.21.-) (LIVER AND SPLEEN DNASE) (LS-DNASE) (LSD) - MUS MUSCULUS (MOUSE).
DRNL_HUMAN MUSCLE-SPECIFIC DNASE I-LIKE PRECURSOR (EC 3.1.21.-) (DNASE X) (XIB) - HOMO SAPIENS (HUMAN).
O42446 DEOXYRIBONUCLEASE I PRECURSOR (EC 3.1.21.1) - OREOCHROMIS MOSSAMBICUS (MOZAMBIQUE TILAPIA) (TILAPIA MOSSAMBICA).
O75803 DNASE GAMMA - HOMO SAPIENS (HUMAN).

O89107 DNASEY - RATTUS NORVEGICUS (RAT).
Scan History
OWL22_1    2  100  NSINGLE    
OWL26_0 1 100 NSINGLE
SPTR37_9f 2 42 NSINGLE
Initial Motifs
Motif 1  width=30
Element Seqn Id St Int Rpt
FGETKMSNATLSSYIVRILRRYDIALIEQV DRN1_SHEEP 11 11 -
FGETKMSNATLASYIVRIVRRYDIVLIQEV DRN1_BOVIN 11 11 -
FGETKMSNATLVSYIVQILSRYDIALVQEV DRN1_HUMAN 33 33 -

Motif 2 width=30
Element Seqn Id St Int Rpt
RDSHLVAVGKLLDDLNQDDPNSYHYVVSEP DRN1_SHEEP 41 0 -
RDSHLVAVGKLLDYLNQDDPNTYHYVVSEP DRN1_BOVIN 41 0 -
RDSHLTAVGKLLDNLNQDAPDTYHYVVSEP DRN1_HUMAN 63 0 -

Motif 3 width=30
Element Seqn Id St Int Rpt
YLFVFRPNKVSVLDTYQYDDGCESCGNDSF DRN1_SHEEP 80 9 -
YLFLFRPNKVSVLDTYQYDDGCESCGNDSF DRN1_BOVIN 80 9 -
YLFVYRPDQVSAVDSYYYDDGCEPCGNDTF DRN1_HUMAN 102 9 -

Motif 4 width=30
Element Seqn Id St Int Rpt
VKAFAIVPLHSAPSDAVAEINSLYDVYLDV DRN1_SHEEP 125 15 -
VKEFAIVALHSAPSDAVAEINSLYDVYLDV DRN1_BOVIN 125 15 -
VREFAIVPLHAAPGDAVAEIDALYDVYLDV DRN1_HUMAN 147 15 -

Motif 5 width=30
Element Seqn Id St Int Rpt
QQKWDLNDIMLMGDFNADCSYVTSSQWSSI DRN1_SHEEP 155 0 -
QQKWHLNDVMLMGDFNADCSYVTSSQWSSI DRN1_BOVIN 155 0 -
QEKWGLEDVMLMGDFNAGCSYVRPSQWSSI DRN1_HUMAN 177 0 -

Motif 6 width=30
Element Seqn Id St Int Rpt
RLRTSSTFQWLIPDSADTTATSTNCAYDRI DRN1_SHEEP 185 0 -
RLRTSSTFQWLIPDSADTTATSTNCAYDRI DRN1_BOVIN 185 0 -
RLWTSPTFQWLIPDSADTTATPTHCAYDRI DRN1_HUMAN 207 0 -

Motif 7 width=23
Element Seqn Id St Int Rpt
IVVAGSLLQSSVVGPSAVPFDFQ DRN1_SHEEP 214 -1 -
IVVAGSLLQSSVVPGSAAPFDFQ DRN1_BOVIN 214 -1 -
IVVAGMLLRGAVVPDSALPFNFQ DRN1_HUMAN 236 -1 -

Motif 8 width=21
Element Seqn Id St Int Rpt
AAYGLSNEMALAISDHYPVEV DRN1_SHEEP 237 0 -
AAYGLSNEMALAISDHYPVEV DRN1_BOVIN 237 0 -
AAYGLSDQLAQAISDHYPVEV DRN1_HUMAN 259 0 -
Final Motifs
Motif 1  width=30
Element Seqn Id St Int Rpt
FGETKMSNATLSVYFVKILSRYDIAVIQEV DRN1_MOUSE 33 33 -
FGETKMSNATLSSYIVRILRRYDIALIEQV DRN1_SHEEP 11 11 -
FGETKMSNATLASYIVRIVRRYDIVLIQEV DRN1_BOVIN 11 11 -
FGETKMSNATLVSYIVQILSRYDIALVQEV DRN1_HUMAN 33 33 -
FGDTKMSNATLSSYIVKILSRYDIAVVQEV DRN1_RAT 33 33 -
FGETKMSNATLTSYIVRILQRYDIALIQEV DRN1_RABIT 32 32 -
FGETKMSNATLSNYIVRILSRYDIALIQEV DRN1_PIG 11 11 -
FGDSKVSDPACGSIIAKILAGYDLALVQEV DHP1_HUMAN 32 32 -

Motif 2 width=30
Element Seqn Id St Int Rpt
RDSHLVAVGKLLDELNRDKPDTYRYVVSEP DRN1_MOUSE 63 0 -
RDSHLVAVGKLLDDLNQDDPNSYHYVVSEP DRN1_SHEEP 41 0 -
RDSHLVAVGKLLDYLNQDDPNTYHYVVSEP DRN1_BOVIN 41 0 -
RDSHLTAVGKLLDNLNQDAPDTYHYVVSEP DRN1_HUMAN 63 0 -
RDTHLVAVGKLLDELNRDIPDNYRYIISEP DRN1_RAT 63 0 -
RDSHLTAVGKLLDKLNEKAADTYRFVASEP DRN1_RABIT 62 0 -
RDSHLTAVGKLLNELNQDDPNNYHHVVSEP DRN1_PIG 41 0 -
RDPDLSAVSALMEQINSVSEHEYSFVSSQP DHP1_HUMAN 62 0 -

Motif 3 width=30
Element Seqn Id St Int Rpt
YLFVYRPDQVSILDSYQYDDGCEPCGNDTF DRN1_MOUSE 102 9 -
YLFVFRPNKVSVLDTYQYDDGCESCGNDSF DRN1_SHEEP 80 9 -
YLFLFRPNKVSVLDTYQYDDGCESCGNDSF DRN1_BOVIN 80 9 -
YLFVYRPDQVSAVDSYYYDDGCEPCGNDTF DRN1_HUMAN 102 9 -
YLFVYRPSQVSVLDSYHYDDGCEPCGNDTF DRN1_RAT 102 9 -
YLFVYRPDQVSVLDSYYYDDGCEPCGTDTF DRN1_RABIT 101 9 -
YLFVFRPNQVSVLDSYLYDDGCEPCGNDTF DRN1_PIG 80 9 -
YLFVYRKDAVSVVDTYLYPDPEDVFSREPF DHP1_HUMAN 101 9 -

Motif 4 width=30
Element Seqn Id St Int Rpt
VQEFAIVPLHAAPTEAVSEIDALYDVYLDV DRN1_MOUSE 147 15 -
VKAFAIVPLHSAPSDAVAEINSLYDVYLDV DRN1_SHEEP 125 15 -
VKEFAIVALHSAPSDAVAEINSLYDVYLDV DRN1_BOVIN 125 15 -
VREFAIVPLHAAPGDAVAEIDALYDVYLDV DRN1_HUMAN 147 15 -
VREFAIVPLHSAPTEAVSEIDALYDVYLDV DRN1_RAT 147 15 -
VREFAIVPLHSAPEDAVAEIDALYDVYLDV DRN1_RABIT 146 15 -
VKEFAIVPLHAAPSDAAAEINSLYDVYLNV DRN1_PIG 125 15 -
AQNLVLIPLHAAPHQAVAEIDALYDVYLDV DHP1_HUMAN 161 30 -

Motif 5 width=30
Element Seqn Id St Int Rpt
WQKWGLEDIMFMGDFNAGCSYVTSSQWSSI DRN1_MOUSE 177 0 -
QQKWDLNDIMLMGDFNADCSYVTSSQWSSI DRN1_SHEEP 155 0 -
QQKWHLNDVMLMGDFNADCSYVTSSQWSSI DRN1_BOVIN 155 0 -
QEKWGLEDVMLMGDFNAGCSYVRPSQWSSI DRN1_HUMAN 177 0 -
RQKWGLEDIMFMGDFNAGCSYVTSSQWSSI DRN1_RAT 177 0 -
QKKWGLQDVMLMGDFNADYSYVTSSQWSSI DRN1_RABIT 176 0 -
RQKWDLQDIMLMGDFNAGCSYVTTSHWSSI DRN1_PIG 155 0 -
IDKWGTDDMLFLGDFNADCSYVRAQDWAAI DHP1_HUMAN 191 0 -

Motif 6 width=30
Element Seqn Id St Int Rpt
RLRTSPIFQWLIPDSADTTVTSTHCAYDRI DRN1_MOUSE 207 0 -
RLRTSSTFQWLIPDSADTTATSTNCAYDRI DRN1_SHEEP 185 0 -
RLRTSSTFQWLIPDSADTTATSTNCAYDRI DRN1_BOVIN 185 0 -
RLWTSPTFQWLIPDSADTTATPTHCAYDRI DRN1_HUMAN 207 0 -
RLRTSPIFQWLIPDSADTTATSTHCAYDRI DRN1_RAT 207 0 -
RLRTNPAFKWLIPDTADTTATSTNCAYDRI DRN1_RABIT 206 0 -
RLRESPPFQWLIPDTADTTVSSHTCAYDRI DRN1_PIG 185 0 -
RLRSSEVFKWLIPDSADTTVGNSDCAYDRI DHP1_HUMAN 221 0 -

Motif 7 width=23
Element Seqn Id St Int Rpt
IVVAGALLQAAVVPNSAVPFDFQ DRN1_MOUSE 236 -1 -
IVVAGSLLQSSVVGPSAVPFDFQ DRN1_SHEEP 214 -1 -
IVVAGSLLQSSVVPGSAAPFDFQ DRN1_BOVIN 214 -1 -
IVVAGMLLRGAVVPDSALPFNFQ DRN1_HUMAN 236 -1 -
IVVAGALLQAAVVPSSAVPFDFQ DRN1_RAT 236 -1 -
IVVAGPLLQDAVVPNSAAPFNFQ DRN1_RABIT 235 -1 -
IVVAGPLLQRAVVPDSAAPFDFQ DRN1_PIG 214 -1 -
IVACGARLRRSLKPQSATVHDFQ DHP1_HUMAN 250 -1 -

Motif 8 width=21
Element Seqn Id St Int Rpt
AEYGLSNQLAEAISDHYPVEV DRN1_MOUSE 259 0 -
AAYGLSNEMALAISDHYPVEV DRN1_SHEEP 237 0 -
AAYGLSNEMALAISDHYPVEV DRN1_BOVIN 237 0 -
AAYGLSDQLAQAISDHYPVEV DRN1_HUMAN 259 0 -
AEYRLTNQMAEAISDHYPVEV DRN1_RAT 259 0 -
AAYGLSNQLAQAISDHYPVEV DRN1_RABIT 258 0 -
AAFGLSQETALAISDHYPVEV DRN1_PIG 237 0 -
EEFGLDQTQALAISDHFPVEV DHP1_HUMAN 273 0 -