SPRINT Home UMBER Home Contents Standard Search Advanced Search Relation Search

==SPRINT==> PRINTS View



  selected as


PR01838

Identifier
NCAMFAMILY  [View Relations]  [View Alignment]  
Accession
PR01838
No. of Motifs
4
Creation Date
19-FEB-2003
Title
Neural cell adhesion molecule signature
Database References

MIM; 116930
Literature References
1. WALSH, F.S AND DOHERTY, P.
Glycosylphosphatidylinositol anchored recognition molecules that function in
axonal fasciculation, growth and guidance in the nervous system.
CELL BIOL.INT.REP. 15 1151-1166 (1991).
 
2. BALDWIN, T.J., FAZELI, M.S., DOHERTY, P. AND WALSH, F.S. 
Elucidation of the molecular actions of NCAM and structurally related cell
adhesion molecules.
J.CELL BIOCHEM. 61 502-513 (1996).
 
3. RIEGER, F., GRUMET, M. AND EDELMAN, G.M. 
N-CAM at the vertebrate neuromuscular junction.
J.CELL BIOL. 101 285-293 (1985).
 
4. HOFFMAN, S. AND EDELMAN G.M.
Kinetics of homophilic binding by embryonic and adult forms of the neural
cell adhesion molecule.
PROC.NATL.ACAD.SCI.U.S.A. 80 5762-5766 (1983).
 
5. WATANABE, M.
The neural cell adhesion molecule and heart development: What is NCAM doing
in the heart?
BASIC APPL.MYOL. 8 277-291 (1998).
 
6. WALSH, F.S. AND DOHERTY, P.
Neural cell adhesion molecules of the immunoglobulin superfamily: role in
axon growth and guidance.
ANNUAL REV.CELL DEV.BIOL. 13 425-456. (1997).

Documentation
Neural cell adhesion molecules (NCAM) are cell surface glycoproteins that
share structural motifs related to immunoglobulin (Ig) and fibronectin type
III (FNIII) domains. Expressed in neurons, glial cells and skeletal muscle,
NCAM binds both homophilically and heterophilically, mediating processes
such as neural cell growth and migration [1-3]. Polysialic acid binds to
N-glycosylation sites in the Ig domains, affecting the binding of NCAM.
Decreasing levels of sialynation on NCAM promotes aggregation [4], and is
thought to be important in regulation of tissue stability [5].
 
The full length transcript contains (from N-terminus to C-terminus) five Ig
domains, two FNIII domains, a transmemrane (TM) region and a cytosolic
domain. Alternative splicing is known to generate at least four products
with (apparent desialylated) molecular weights of 180, 140, 120 and 105kDa.
The longer TM products are expressed in neurons (180 and 140kDa) and glial
cells (140 kDa), whereas the 120kDa product is GPI-anchored on the surface
of myotubes and the 105kDa product is secreted (for review see [5,6]).
Further splice variation arises from a variable alternatively spliced exon 
(VASE) in the fourth Ig domain and a muscle-specific domain (MSD) between
the two FNIII domains containing an O-glycosylation site [5].
 
NCAMFAMILY is a 4-element fingerprint that provides a signature for the
neural cell adhesion molecule family. The fingerprint was derived from an
initial alignment of 8 sequences: the motifs were drawn from conserved
regions spanning the N-terminal Ig-domain-containing region - motif 1 
contains the N-terminal portion of the first Ig domain; motif 2 contains
the N-terminal portion of the second Ig domain; motif 3 includes the
C-terminal portion of the second Ig domain; and motif 4 includes the 
C-terminal portion of the third Ig domain. Two iterations on SPTR40_20f
were required to reach convergence, at which point a true set comprising 19
sequences was identified.
Summary Information
19 codes involving  4 elements
0 codes involving 3 elements
0 codes involving 2 elements
Composite Feature Index
419191919
30000
20000
1234
True Positives
NCA1_BOVIN    NCA1_CHICK    NCA1_HUMAN    NCA1_MOUSE    
NCA1_RAT NCA1_XENLA NCA2_HUMAN NCA2_MOUSE
NCA2_XENLA NCM2_HUMAN NCM2_MOUSE O57576
O57577 O73633 O73634 Q90YM0
Q90YM1 Q90YM2 Q921P2
Sequence Titles
NCA1_BOVIN  Neural cell adhesion molecule, 140 kDa isoform precursor (N-CAM 140) (NCAM-140) - Bos taurus (Bovine). 
NCA1_CHICK Neural cell adhesion molecule, large isoform precursor (N-CAM 180) [Contains: N-CAM 140] - Gallus gallus (Chicken).
NCA1_HUMAN Neural cell adhesion molecule, 140 kDa isoform precursor (N-CAM 140) (NCAM-140) (CD56 antigen) - Homo sapiens (Human).
NCA1_MOUSE Neural cell adhesion molecule, large isoform precursor (N-CAM 180) (NCAM-180) [Contains: N-CAM 140 (NCAM-140)] - Mus musculus (Mouse).
NCA1_RAT Neural cell adhesion molecule, 140 kDa isoform precursor (N-CAM 140) (NCAM-140) - Rattus norvegicus (Rat).
NCA1_XENLA Neural cell adhesion molecule 1, large isoform precursor (N-CAM 180) [Contains: N-CAM 140] - Xenopus laevis (African clawed frog).
NCA2_HUMAN Neural cell adhesion molecule, phosphatidylinositol-linked isoform precursor (N-CAM 120) (NCAM-120) (CD56 antigen) - Homo sapiens (Human).
NCA2_MOUSE Neural cell adhesion molecule, phosphatidylinositol-linked isoform precursor (N-CAM 120) (NCAM-120) - Mus musculus (Mouse).
NCA2_XENLA Neural cell adhesion molecule 2, large isoform precursor (N-CAM 180) - Xenopus laevis (African clawed frog).
NCM2_HUMAN Neural cell adhesion molecule 2 precursor (N-CAM 2) - Homo sapiens (Human).
NCM2_MOUSE Neural cell adhesion molecule 2 precursor (N-CAM 2) (RB-8 neural cell adhesion molecule) (R4B12) - Mus musculus (Mouse).
O57576 NCAM-180 - Cynops pyrrhogaster (Japanese common newt).
O57577 NCAM-140 - Cynops pyrrhogaster (Japanese common newt).
O73633 NEURAL CELL ADHESION MOLECULE - Xenopus laevis (African clawed frog).
O73634 NEURAL CELL ADHESION MOLECULE - Xenopus laevis (African clawed frog).
Q90YM0 CELL ADHESION MOLECULE OCAM - Brachydanio rerio (Zebrafish) (Zebra danio).
Q90YM1 CELL ADHESION MOLECULE NCAM - Brachydanio rerio (Zebrafish) (Zebra danio).
Q90YM2 CELL ADHESION MOLECULE PCAM - Brachydanio rerio (Zebrafish) (Zebra danio).
Q921P2 UNKNOWN (PROTEIN FOR MGC:12077) - Mus musculus (Mouse).
Scan History
SPTR40_20f 2  50   NSINGLE    
Initial Motifs
Motif 1  width=28
Element Seqn Id St Int Rpt
LQVDIVPSQGEISVGESKFFLCQVAGDA NCA1_RAT 20 20 -
LQVDIVPSQGEISVGESKFFLCQVAGDA NCA1_BOVIN 20 20 -
LQVDIVPSQGEISVGESKFFLCQVAGDA NCA1_HUMAN 20 20 -
LQVDIVPSQGEISVGESKFFLCQVAGEA NCA1_CHICK 20 20 -
LEVNIVPDQGEISLGESKFFLCQVSGEA NCA1_XENLA 20 20 -
LEVNIVPDQGEISLGESKFFLCQVSGEA NCA2_XENLA 20 20 -
LQVTISLSKVELSVGESKFFTCTAIGEP NCM2_HUMAN 21 21 -
LQVTISLSKVELSVGESKFFTCTAIGEP NCM2_MOUSE 21 21 -

Motif 2 width=28
Element Seqn Id St Int Rpt
KIFQKLMFKNAPTPQEFKEGEDAVIVCD NCA1_RAT 113 65 -
KIFQKLMFKNAPTPQEFREGEDAVIVCD NCA1_BOVIN 113 65 -
KIFQKLMFKNAPTPQEFREGEDAVIVCD NCA1_HUMAN 113 65 -
KIFQKLMFKNAPTPQEFKEGDDAVIVCD NCA1_CHICK 113 65 -
KIYQKLTFKNAPTPQEFKEGEDAVIICD NCA1_XENLA 110 62 -
KIYQKLTFKYAPTPQEFTEGEDAVIICD NCA2_XENLA 110 62 -
EIYQKLTFREVVSPQEFKQGEDAEVVCR NCM2_HUMAN 110 61 -
EIYQKLTFREVVSPQEFKQGEDAEVVCR NCM2_MOUSE 110 61 -

Motif 3 width=29
Element Seqn Id St Int Rpt
GRILARGEINFKDIQVIVNVPPTVQARQS NCA1_RAT 191 50 -
GRILARGEINFKDIQVIVNVPPTVQARQS NCA1_BOVIN 191 50 -
GRILARGEINFKDIQVIVNVPPTIQARQN NCA1_HUMAN 191 50 -
GRILARGEINFKDIQVIVNVPPSVRARQS NCA1_CHICK 191 50 -
GRILARGEINYKDIQVIVNVPPTIQARQL NCA1_XENLA 188 50 -
GRILARGEINYKDIQVIVNVPPLIQARQI NCA2_XENLA 188 50 -
GRVEARGEIDFRDIIVIVNVPPAISMPQK NCM2_HUMAN 188 50 -
GRVEARGEIDFRDIIVIVNVPPAIMMPQK NCM2_MOUSE 188 50 -

Motif 4 width=30
Element Seqn Id St Int Rpt
YVCIAENKAGEQDASIHLKVFAKPKITYVE NCA1_RAT 286 66 -
YVCIAENKAGEQDASIHLKVFAKPKITYVE NCA1_BOVIN 284 64 -
YICIAENKAGEQDATIHLKVFAKPKITYVE NCA1_HUMAN 285 65 -
YICIAENKAGEQDATIHLKVFAKPKITYVE NCA1_CHICK 285 65 -
YSCIANNQAGEAEATILLKVYAKPKITYVE NCA1_XENLA 280 63 -
YSCIANNQAGEAEAIVLLKVYAKPKMTYVE NCA2_XENLA 280 63 -
YVCRATNKAGEDEKQAFLQVFVQPHIIQLK NCM2_HUMAN 279 62 -
YVCKATNKAGEDQKQAFLQVFVQPHILQLK NCM2_MOUSE 279 62 -
Final Motifs
Motif 1  width=28
Element Seqn Id St Int Rpt
LQVDIVPSQGEISVGESKFFLCQVAGDA NCA1_MOUSE 20 20 -
LQVDIVPSQGEISVGESKFFLCQVAGDA NCA1_RAT 20 20 -
LQVDIVPSQGEISVGESKFFLCQVAGDA NCA2_MOUSE 20 20 -
LQVDIVPSQGEISVGESKFFLCQVAGDA Q921P2 20 20 -
LQVDIVPSQGEISVGESKFFLCQVAGDA NCA1_BOVIN 20 20 -
LQVDIVPSQGEISVGESKFFLCQVAGDA NCA1_HUMAN 20 20 -
LQVDIVPSQGEISVGESKFFLCQVAGDA NCA2_HUMAN 20 20 -
LQVDIVPSQGEISVGESKFFLCQVAGEA NCA1_CHICK 20 20 -
LEVNIVPDQGEISLGESKFFLCQVSGEA NCA1_XENLA 20 20 -
LEVNIVPDQGEISLGESKFFLCQVSGEA O73633 20 20 -
LEVTIVPDQGEISLGESKFFLCQVSGEA O73634 20 20 -
LEVNIVPDQGEISLGESKFFLCQVSGEA NCA2_XENLA 20 20 -
IQVTVVPSQVDVDVGESKFFSCQVTGGE O57576 20 20 -
IQVTVVPSQVDVDVGESKFFSCQVTGGE O57577 20 20 -
LQVEITPTQGEISVGESKFFLCEVVGDA Q90YM1 20 20 -
LQVDITPAHGEISVGESRFFLCEVIGGA Q90YM2 20 20 -
LQVTISLSKVELSVGESKFFTCTAIGEP NCM2_HUMAN 21 21 -
LQVTISLSKVELSVGESKFFTCTAIGEP NCM2_MOUSE 21 21 -
LQVSISLKKVELSVGESKFFTCTVIGEP Q90YM0 20 20 -

Motif 2 width=28
Element Seqn Id St Int Rpt
KIFQKLMFKNAPTPQEFKEGEDAVIVCD NCA1_MOUSE 113 65 -
KIFQKLMFKNAPTPQEFKEGEDAVIVCD NCA1_RAT 113 65 -
KIFQKLMFKNAPTPQEFKEGEDAVIVCD NCA2_MOUSE 113 65 -
KIFQKLMFKNAPTPQEFKEGEDAVIVCD Q921P2 113 65 -
KIFQKLMFKNAPTPQEFREGEDAVIVCD NCA1_BOVIN 113 65 -
KIFQKLMFKNAPTPQEFREGEDAVIVCD NCA1_HUMAN 113 65 -
KIFQKLMFKNAPTPQEFREGEDAVIVCD NCA2_HUMAN 113 65 -
KIFQKLMFKNAPTPQEFKEGDDAVIVCD NCA1_CHICK 113 65 -
KIYQKLTFKNAPTPQEFKEGEDAVIICD NCA1_XENLA 110 62 -
KIYQKLTFKNAPTPQEFKEGEDAVIICD O73633 110 62 -
KIYQKLTFKYAPTPQEFTEGEDAVIICD O73634 110 62 -
KIYQKLTFKYAPTPQEFTEGEDAVIICD NCA2_XENLA 110 62 -
QIYQKMVFRNAPSPQEFTEGEDAVVVCD O57576 112 64 -
QIYQKMVFRNAPSPQEFTEGEDAVVVCD O57577 112 64 -
KIFQKLTFQYAPSPQEFKEGDDADIICD Q90YM1 110 62 -
KIYQKITFTNVPSPQEFTEGDNAIIVCD Q90YM2 110 62 -
EIYQKLTFREVVSPQEFKQGEDAEVVCR NCM2_HUMAN 110 61 -
EIYQKLTFREVVSPQEFKQGEDAEVVCR NCM2_MOUSE 110 61 -
EIYQKLTFRDVRSPQEFRQGEVAEVVCD Q90YM0 109 61 -

Motif 3 width=29
Element Seqn Id St Int Rpt
GRILARGEINFKDIQVIVNVPPTVQARQS NCA1_MOUSE 191 50 -
GRILARGEINFKDIQVIVNVPPTVQARQS NCA1_RAT 191 50 -
GRILARGEINFKDIQVIVNVPPTVQARQS NCA2_MOUSE 191 50 -
GRILARGEINFKDIQVIVNVPPTVQARQS Q921P2 191 50 -
GRILARGEINFKDIQVIVNVPPTVQARQS NCA1_BOVIN 191 50 -
GRILARGEINFKDIQVIVNVPPTIQARQN NCA1_HUMAN 191 50 -
GRILARGEINFKDIQVIVNVPPTIQARQN NCA2_HUMAN 191 50 -
GRILARGEINFKDIQVIVNVPPSVRARQS NCA1_CHICK 191 50 -
GRILARGEINYKDIQVIVNVPPTIQARQL NCA1_XENLA 188 50 -
GRILARGEINYKDIQVIVNVPPTIQARQL O73633 188 50 -
GRILARGEINYKDIQVIVNVPPLIQARQI O73634 188 50 -
GRILARGEINYKDIQVIVNVPPLIQARQI NCA2_XENLA 188 50 -
GRIQARGEIAFKDIQVVVNVAPSVRARQT O57576 190 50 -
GRIQARGEIAFKDIQVVVNVAPSVRARQT O57577 190 50 -
GRIMARGEIDLRVIKVIVNVLPSIRTRYT Q90YM1 188 50 -
GRIKARGEVDFRSIKVVVNVLPTIRIRQA Q90YM2 188 50 -
GRVEARGEIDFRDIIVIVNVPPAISMPQK NCM2_HUMAN 188 50 -
GRVEARGEIDFRDIIVIVNVPPAIMMPQK NCM2_MOUSE 188 50 -
ARVEARGEIDFRNIILVVNVPPVVSVPQQ Q90YM0 186 49 -

Motif 4 width=30
Element Seqn Id St Int Rpt
YVCIAENKAGEQDASIHLKVFAKPKITYVE NCA1_MOUSE 286 66 -
YVCIAENKAGEQDASIHLKVFAKPKITYVE NCA1_RAT 286 66 -
YVCIAENKAGEQDASIHLKVFAKPKITYVE NCA2_MOUSE 286 66 -
YVCIAENKAGEQDASIHLKVFAKPKITYVE Q921P2 286 66 -
YVCIAENKAGEQDASIHLKVFAKPKITYVE NCA1_BOVIN 284 64 -
YICIAENKAGEQDATIHLKVFAKPKITYVE NCA1_HUMAN 285 65 -
YICIAENKAGEQDATIHLKVFAKPKITYVE NCA2_HUMAN 285 65 -
YICIAENKAGEQDATIHLKVFAKPKITYVE NCA1_CHICK 285 65 -
YSCIANNQAGEAEATILLKVYAKPKITYVE NCA1_XENLA 280 63 -
YSCIANNQAGEAEATILLKVYAKPKITYVE O73633 280 63 -
YSCIANNQAGEAEAIVLLKVYAKPKITYVE O73634 280 63 -
YSCIANNQAGEAEAIVLLKVYAKPKMTYVE NCA2_XENLA 280 63 -
YTCIAENKAGEQEASILLKVYAKPKITYVE O57576 282 63 -
YTCIAENKAGEQEASILLKVYAKPKITYVE O57577 282 63 -
YKCIARNKAGERSEEVTLNVFVQPKITFLE Q90YM1 279 62 -
YTCIAKNKAGESEQELSLKVFVQPKITYLE Q90YM2 279 62 -
YVCRATNKAGEDEKQAFLQVFVQPHIIQLK NCM2_HUMAN 279 62 -
YVCKATNKAGEDQKQAFLQVFVQPHILQLK NCM2_MOUSE 279 62 -
YTCRASNKAGEVEHELFLKVFVQPHITKLR Q90YM0 277 62 -