SPRINT Home UMBER Home Contents Standard Search Advanced Search Relation Search

==SPRINT==> PRINTS View



  selected as


PR01361

Identifier
MEROZOITESA  [View Relations]  [View Alignment]  
Accession
PR01361
No. of Motifs
15
Creation Date
29-APR-2000
Title
Apical membrane antigen 1 signature
Database References
Literature References
1. PETERSON, M.G., MARSHALL, V.M., SMYTHE, J.A., CREWTHER, P.E., LEW, A.,
SILVA, A., ANDERS, R.F. AND KEMP, D.J.
Integral membrane protein located in the apical complex of Plasmodium
falciparum. 
MOL.CELL.BIOL. 9 3151-3154 (1989). 
 
2. WATERS, A.P., THOMAS, A.W., DEANS, J.A., MITCHELL, G.H., HUDSON, D.E.,
MILLER, L.H., MCCUTCHAN, T.F. AND COHEN, S.
A merozoite receptor protein from Plasmodium knowlesi is highly conserved
and distributed throughout Plasmodium.
J.BIOL.CHEM. 265 17974-17979 (1990). 

Documentation
A novel antigen of Plasmodium falciparum has been cloned that contains a
hydrophobic domain typical of an integral membrane protein [1]. The antigen
is designated apical membrane antigen 1 (AMA-1) by virtue of appearing to 
be located in the apical complex [1]. AMA-1 appears to be transported to 
the merozoite surface close to the time of schizont rupture [1]. 
 
The 66kDa merozoite surface antigen (PK66) of Plasmodium knowlesi, a simian
malaria, possesses vaccine-related properties believed to originate from a 
receptor-like role in parasite invasion of erythrocytes [2]. The sequence
of PK66 is conserved throughout Plasmodium, and shows high similarity to
P.falciparum AMA-1. Following schizont rupture, the distribution of PK66 
changes in a coordinate manner associated with merozoite invasion [2]. Prior
to rupture, the protein is concentrated at the apical end, following which
it distributes itself entirely across the surface of the free merozoite [2].
Immunofluorescence studies suggest that, during invasion, PK66 is excluded
from the erythrocyte at, and behind, the invasion interface [2]. 
 
MEROZOITESA is a 15-element fingerprint that provides a signature for 
apical membrane antigen 1 proteins. The fingerprint was derived from an 
initial alignment of 7 sequences: the motifs were drawn from conserved 
regions spanning virtually the full alignment length, spanning the N- and
C-terminal flanks of the putative TM domain - motifs 1-13 lie in the
putative extracellular domain; and motifs 14 and 15 reside in the putative
cytoplasmic domain. Two iterations on SPTR37_10f were required to reach
convergence, at which point a true set comprising 14 sequences was 
identified. A single partial match was also found, O15681, an apical
membrane antigen 1 homologue from Toxoplasma gondii that matches 4 motifs.

Summary Information
  14 codes involving 15 elements
0 codes involving 14 elements
0 codes involving 13 elements
0 codes involving 12 elements
0 codes involving 11 elements
0 codes involving 10 elements
0 codes involving 9 elements
0 codes involving 8 elements
0 codes involving 7 elements
0 codes involving 6 elements
0 codes involving 5 elements
1 codes involving 4 elements
0 codes involving 3 elements
0 codes involving 2 elements
Composite Feature Index
15141414141414141414141414141414
14000000000000000
13000000000000000
12000000000000000
11000000000000000
10000000000000000
9000000000000000
8000000000000000
7000000000000000
6000000000000000
5000000000000000
4011001000010000
3000000000000000
2000000000000000
123456789101112131415
True Positives
AMA1_PLACH    AMA1_PLAF8    AMA1_PLAFC    AMA1_PLAFF    
AMA1_PLAFG AMA1_PLAFH AMA1_PLAFR O61130
PK66_PLAKU Q25657 Q25687 Q26224
Q26225 Q94661
True Positive Partials
Codes involving 4 elements
O15681
Sequence Titles
AMA1_PLACH  APICAL MEMBRANE ANTIGEN 1 PRECURSOR (MEROZOITE SURFACE ANTIGEN) - PLASMODIUM CHABAUDI. 
AMA1_PLAF8 APICAL MEMBRANE ANTIGEN 1 PRECURSOR (MEROZOITE SURFACE ANTIGEN) - PLASMODIUM FALCIPARUM (ISOLATE 7G8).
AMA1_PLAFC APICAL MEMBRANE ANTIGEN 1 PRECURSOR (MEROZOITE SURFACE ANTIGEN) - PLASMODIUM FALCIPARUM (ISOLATE CAMP / MALAYSIA).
AMA1_PLAFF APICAL MEMBRANE ANTIGEN 1 PRECURSOR (MEROZOITE SURFACE ANTIGEN) - PLASMODIUM FALCIPARUM (ISOLATE FC27 / PAPUA NEW GUINEA).
AMA1_PLAFG APICAL MEMBRANE ANTIGEN 1 PRECURSOR (MEROZOITE SURFACE ANTIGEN) - PLASMODIUM FALCIPARUM (ISOLATE FCR-3 / GAMBIA).
AMA1_PLAFH APICAL MEMBRANE ANTIGEN 1 PRECURSOR (MEROZOITE SURFACE ANTIGEN) - PLASMODIUM FALCIPARUM (ISOLATE THTN / THAILAND).
AMA1_PLAFR APICAL MEMBRANE ANTIGEN 1 PRECURSOR (MEROZOITE SURFACE ANTIGEN) - PLASMODIUM FRAGILE.
O61130 APICAL MEROZOITE ANTIGEN 1 - PLASMODIUM VIVAX.
PK66_PLAKU MEROZOITE RECEPTOR PK66 PRECURSOR (66 KD PROTECTIVE MINOR SURFACE ANTIGEN) - PLASMODIUM KNOWLESI (STRAIN NURI).
Q25657 APICAL MEMBRANE ANTIGEN-1 - PLASMODIUM BERGHEI.
Q25687 APICAL MEMBRANE ANTIGEN 1 - PLASMODIUM CHABAUDI.
Q26224 APICAL MEMBRANE ANTIGEN-1 - PLASMODIUM BERGHEI YOELII.
Q26225 APICAL MEMBRANE ANTIGEN-1 - PLASMODIUM BERGHEI YOELII.
Q94661 APICAL MEMBRANE ANTIGEN 1 (APICAL MEMBRANE ANTIGEN-1) - PLASMODIUM FALCIPARUM.

O15681 APICAL MEMBRANE ANTIGEN 1 HOMOLOG - TOXOPLASMA GONDII.
Scan History
SPTR37_10f 2  40   NSINGLE    
Initial Motifs
Motif 1  width=19
Element Seqn Id St Int Rpt
RSNYMGNPWTEYMAKYDIE AMA1_PLAFF 102 102 -
RSNYMGNPWTEYMAKYDIE AMA1_PLAFC 102 102 -
RSNYMGNPWTEYMAKYDIE AMA1_PLAFG 102 102 -
RSNYMGNPWTEYMAKYDIE AMA1_PLAFH 102 102 -
RSNYMGNPWTEYMAKYDIK AMA1_PLAF8 102 102 -
RSHKLINPWEKFMEKYDIE AMA1_PLACH 47 47 -
RSTRMSNPWKAFMEKYDIE AMA1_PLAFR 47 47 -

Motif 2 width=20
Element Seqn Id St Int Rpt
HGSGIRVDLGEDAEVAGTQY AMA1_PLAFF 123 2 -
HGSGIRVDLGEDAEVAGTQY AMA1_PLAFC 123 2 -
HGSGIRVDLGEDAEVAGTQY AMA1_PLAFG 123 2 -
HGSGIRVDLGEDAEVAGTQY AMA1_PLAFH 123 2 -
HGSGIRVDLGEDAEVAGTQY AMA1_PLAF8 123 2 -
HGSGIRVDLGEDARVENQDY AMA1_PLACH 68 2 -
HSSGIRVDLGEDAEVGNSSY AMA1_PLAFR 68 2 -

Motif 3 width=19
Element Seqn Id St Int Rpt
RLPSGKCPVFGKGIIIENS AMA1_PLAFF 143 0 -
RLPSGKCPVFGKGIIIENS AMA1_PLAFC 143 0 -
RLPSGKCPVFGKGIIIENS AMA1_PLAFG 143 0 -
RLPSGKCPVFGKGIIIENS AMA1_PLAFH 143 0 -
RLPSGKCPVFGKGIIIENS AMA1_PLAF8 143 0 -
RIPSGKCPVMGKGITIQNS AMA1_PLACH 88 0 -
RIPAGKCPVFGKGIVIQNS AMA1_PLAFR 88 0 -

Motif 4 width=20
Element Seqn Id St Int Rpt
FLTPVATGNQYLKDGGFAFP AMA1_PLAFF 165 3 -
FLKPVATGNQDLKDGGFAFP AMA1_PLAFC 165 3 -
FLKPVATGNQDLKDGGFAFP AMA1_PLAFG 165 3 -
FLTPVATENQDLKDGGFAFP AMA1_PLAFH 165 3 -
FLKPVATGNQDLKDGGFAFP AMA1_PLAF8 165 3 -
FLTRVATGNQKVREGGLAFP AMA1_PLACH 110 3 -
FLTPVATGNQKLKDGGFAFP AMA1_PLAFR 110 3 -

Motif 5 width=22
Element Seqn Id St Int Rpt
LDELTLCSRHAGNMIPDNDKNS AMA1_PLAFF 211 26 -
LDELTLCSRHAGNMNPDKDENS AMA1_PLAFC 211 26 -
LDELTLCSRHAGNMNPDNDKNS AMA1_PLAFG 211 26 -
LDELTLCSRHAGNMNPDNDKNS AMA1_PLAFH 211 26 -
LDELTLCSRHAGNMNPDNDKNS AMA1_PLAF8 211 26 -
LNDMSLCAKHASFYVPGTNVNT AMA1_PLACH 156 26 -
LNDLALCKTHAASFVMEMDKNS AMA1_PLAFR 156 26 -

Motif 6 width=24
Element Seqn Id St Int Rpt
YKYPAVYDDKDKKCHILYIAAQEN AMA1_PLAFF 234 1 -
YKYPAVYDDKDKKCHILYIAAQEN AMA1_PLAFC 234 1 -
YKYPAVYDYNDKKCHILYIAAQEN AMA1_PLAFG 234 1 -
YKYPAVYDYEDKKCHILYIAAQEN AMA1_PLAFH 234 1 -
YKYPAVYDYNDKKCHILYIAAQEN AMA1_PLAF8 234 1 -
YRHPAVYDKSNKTCYILYVAAQEN AMA1_PLACH 179 1 -
YRHPAVYDEDKKICYMLYLSAQEN AMA1_PLAFR 179 1 -

Motif 7 width=20
Element Seqn Id St Int Rpt
GPRYCNKDESKRNSMFCFRP AMA1_PLAFF 259 1 -
GPRYCNKDESKRNSMFCFRP AMA1_PLAFC 259 1 -
GPRYCNKDQSKRNSMFCFRP AMA1_PLAFG 259 1 -
GPRYCNKDESKRNSMFCFRP AMA1_PLAFH 259 1 -
GPRYCNKDESKRNSMFCFRP AMA1_PLAF8 259 1 -
GPRYCSNEEDNENQPFCFTP AMA1_PLACH 204 1 -
GPRYCSKDAENKDAMFCFKP AMA1_PLAFR 204 1 -

Motif 8 width=30
Element Seqn Id St Int Rpt
YLSKNVVDNWEKVCPRKNLQNAKFGLWVDG AMA1_PLAFF 289 10 -
YLSKNVVDNWEKVCPRKNLENAKFGLWVDG AMA1_PLAFC 289 10 -
YLSKNVVDNWEEVCPRKNLENAKFGLWVDG AMA1_PLAFG 289 10 -
YLSKNVVDNWEEVCPRKNLENAKFGLWVDG AMA1_PLAFH 289 10 -
YLSKNVVDNWEKVCPRKNLENAKFGLWVDG AMA1_PLAF8 289 10 -
YLTKNLREDWETSCPNKSIQNAKFGVWVDG AMA1_PLACH 234 10 -
YLSKNVVNDWQNKCPRKNLGNSKFGLWVDG AMA1_PLAFR 234 10 -

Motif 9 width=19
Element Seqn Id St Int Rpt
ECNKLVFELSASDQPKQYE AMA1_PLAFF 336 17 -
ECNKLVFELSASDQPKQYE AMA1_PLAFC 336 17 -
ECNKLVFELSASDQPKQYE AMA1_PLAFG 336 17 -
ECNKLVFELSASDQPKQYE AMA1_PLAFH 336 17 -
ECNKLVFELSASDQPKQYE AMA1_PLAF8 336 17 -
ECNQIVFNESASDQPKQYE AMA1_PLACH 281 17 -
ECNRIVFEASASDQPTQYE AMA1_PLAFR 281 17 -

Motif 10 width=23
Element Seqn Id St Int Rpt
LPTGAFKADRYKSHGKGYNWGNY AMA1_PLAFF 380 25 -
LPTGAFKADRYKSHGKGYNWGNY AMA1_PLAFC 380 25 -
LPTGAFKADRYKSHGKGYNWGNY AMA1_PLAFG 380 25 -
LPTGAFKADRYKSRGKGYNWGNY AMA1_PLAFH 380 25 -
LPTGAFKADRYKSRGKGYNWGNY AMA1_PLAF8 380 25 -
LPIGSYRADQVKSKGKGYNWANY AMA1_PLACH 325 25 -
LPVGAFNSDNFKSKGRGYNWANF AMA1_PLAFR 325 25 -

Motif 11 width=29
Element Seqn Id St Int Rpt
CEIFNVKPTCLINNSSYIATTALSHPIEV AMA1_PLAFF 409 6 -
CEIFNVKPTCLINNSSYIATTALSHPIEV AMA1_PLAFC 409 6 -
CEIFNVKPTCLINNSSYIATTALSHPIEV AMA1_PLAFG 409 6 -
CEIFNVKPTCLINNSSYIATTALSHPNEV AMA1_PLAFH 409 6 -
CEIFNVKPTCLINNSSYIATTALSHPNEV AMA1_PLAF8 409 6 -
CYIFNKKPTCLINDKDFVATTALSSLEEG AMA1_PLACH 354 6 -
CYLFNAKPTCLINDKNFIATTALSHPQEV AMA1_PLAFR 354 6 -

Motif 12 width=18
Element Seqn Id St Int Rpt
PRIFISDDKDSLKCPCDP AMA1_PLAFF 477 39 -
PRIFISDDKDSLKCPCDP AMA1_PLAFC 477 39 -
PRIFISDDKDSLKCPCDP AMA1_PLAFG 477 39 -
PRIFISDDKDSLKCPCDP AMA1_PLAFH 477 39 -
PRIFISDDIDSLKCPCDP AMA1_PLAF8 477 39 -
PRIFISDDKESLNCPCEP AMA1_PLACH 418 35 -
PRIFISNDKDSLKCPCAP AMA1_PLAFR 419 36 -

Motif 13 width=28
Element Seqn Id St Int Rpt
CNFFVCKCVERRAEVTSNNEVVVKEEYK AMA1_PLAFF 502 7 -
CRFFVCKCVERRAEVTSNNEVVVKEEYK AMA1_PLAFC 502 7 -
CRFFVCKCVERRAEVTSNNEVVVKEEYK AMA1_PLAFG 502 7 -
CNFFVCKCVEKRAEVTSNNEVVVKEEYK AMA1_PLAFH 502 7 -
CNFFVCKCVEKRAEVTSNNEVVVKEEYK AMA1_PLAF8 502 7 -
CKFFVCNCVEKRQFISENNEVEIKDEFK AMA1_PLACH 443 7 -
CNFYVCNCVEKRAEIKENNEVAIKEEFK AMA1_PLAFR 444 7 -

Motif 14 width=21
Element Seqn Id St Int Rpt
YDKMDEPQHYGKSNSRNDEML AMA1_PLAFF 576 46 -
YDKMDQPQDYGKSTSRNDEML AMA1_PLAFC 576 46 -
YDKMDQPQHYGKSTSRNDEML AMA1_PLAFG 576 46 -
YDKMDEPQDYGKSTSRNDEML AMA1_PLAFH 576 46 -
YDKMDEPQDYGKSNSRNDEML AMA1_PLAF8 576 46 -
YDKMGQADTYGKAQSRKDEML AMA1_PLACH 512 41 -
YDKMEQADGYGKPTTRKDEML AMA1_PLAFR 516 44 -

Motif 15 width=25
Element Seqn Id St Int Rpt
DPEASFWGEEKRASHTTPVLMEKPY AMA1_PLAFF 597 0 -
DPEASFWGEEKRASHTTPVLMEKPY AMA1_PLAFC 597 0 -
DPEASFWGEEKRASHTTPVLMEKPY AMA1_PLAFG 597 0 -
DPEASFWGEEKRASHTTPVLMEKPY AMA1_PLAFH 597 0 -
DPEASFWGEEKRASHTTPVLMEKPY AMA1_PLAF8 597 0 -
DPEVSFWGEDKRASHTTPVLMEKPY AMA1_PLACH 533 0 -
DPEASFWGEEKRASHTTPVLMEKPY AMA1_PLAFR 537 0 -
Final Motifs
Motif 1  width=19
Element Seqn Id St Int Rpt
RSNYMGNPWTEYMAKYDIE Q94661 102 102 -
RSNYMGNPWTEYMAKYDIE AMA1_PLAFF 102 102 -
RSNYMGNPWTEYMAKYDIE AMA1_PLAFC 102 102 -
RSNYMGNPWTEYMAKYDIE AMA1_PLAFG 102 102 -
RSNYMGNPWTEYMAKYDIE AMA1_PLAFH 102 102 -
RSNYMGNPWTEYMAKYDIK AMA1_PLAF8 102 102 -
RSHKLINPWEKFMEKYDIE Q25687 47 47 -
RSHKLINPWEKFMEKYDIE AMA1_PLACH 47 47 -
RSTRMSNPWKAFMEKYDIE AMA1_PLAFR 47 47 -
RSIKLINPWDKYMEKYDIE Q26225 47 47 -
RSIKLINPWDKYMEKYDIE Q26224 47 47 -
RSTKLINPWEKYTEKYDIE Q25657 47 47 -
RSTRMSNPWKAFMEKYDIE O61130 47 47 -
RSIRMSNPWKAFMEKYDLE PK66_PLAKU 47 47 -

Motif 2 width=20
Element Seqn Id St Int Rpt
HGSGIRVDLGEDAEVAGTQY Q94661 123 2 -
HGSGIRVDLGEDAEVAGTQY AMA1_PLAFF 123 2 -
HGSGIRVDLGEDAEVAGTQY AMA1_PLAFC 123 2 -
HGSGIRVDLGEDAEVAGTQY AMA1_PLAFG 123 2 -
HGSGIRVDLGEDAEVAGTQY AMA1_PLAFH 123 2 -
HGSGIRVDLGEDAEVAGTQY AMA1_PLAF8 123 2 -
HGSGIRVDLGEDARVENQDY Q25687 68 2 -
HGSGIRVDLGEDARVENQDY AMA1_PLACH 68 2 -
HSSGIRVDLGEDAEVGNSSY AMA1_PLAFR 68 2 -
HGSGIRVDLGEDARVENRDY Q26225 68 2 -
HGSGIRVDLGEDARVENRDY Q26224 68 2 -
HGSGIRVDLGEDARVENRDY Q25657 68 2 -
HSSGVRVDLGEDAEVENAKY O61130 68 2 -
HNSGIRIDLGEDAEVGNSKY PK66_PLAKU 68 2 -

Motif 3 width=19
Element Seqn Id St Int Rpt
RLPSGKCPVFGKGIIIENS Q94661 143 0 -
RLPSGKCPVFGKGIIIENS AMA1_PLAFF 143 0 -
RLPSGKCPVFGKGIIIENS AMA1_PLAFC 143 0 -
RLPSGKCPVFGKGIIIENS AMA1_PLAFG 143 0 -
RLPSGKCPVFGKGIIIENS AMA1_PLAFH 143 0 -
RLPSGKCPVFGKGIIIENS AMA1_PLAF8 143 0 -
RIPSGKCPVMGKGITIQKS Q25687 88 0 -
RIPSGKCPVMGKGITIQNS AMA1_PLACH 88 0 -
RIPAGKCPVFGKGIVIQNS AMA1_PLAFR 88 0 -
RIPSGKCPVIGKGITIQNS Q26225 88 0 -
RIPSGKCPVIGEGITIQNS Q26224 88 0 -
RIPSGKCPVIGKGITIQNS Q25657 88 0 -
RIPAGRCPVFGKGIVIENS O61130 88 0 -
RIPAGKCPVFGKGIVIENS PK66_PLAKU 88 0 -

Motif 4 width=20
Element Seqn Id St Int Rpt
FLTPVATGNQYLKDGGFAFP Q94661 165 3 -
FLTPVATGNQYLKDGGFAFP AMA1_PLAFF 165 3 -
FLKPVATGNQDLKDGGFAFP AMA1_PLAFC 165 3 -
FLKPVATGNQDLKDGGFAFP AMA1_PLAFG 165 3 -
FLTPVATENQDLKDGGFAFP AMA1_PLAFH 165 3 -
FLKPVATGNQDLKDGGFAFP AMA1_PLAF8 165 3 -
FLDPVATGDQKVREGGLAFP Q25687 110 3 -
FLTRVATGNQKVREGGLAFP AMA1_PLACH 110 3 -
FLTPVATGNQKLKDGGFAFP AMA1_PLAFR 110 3 -
FLKPVATGNESVRSGGLPFP Q26225 110 3 -
FLKPVATGDKPVRSGGLAFP Q26224 110 3 -
FLTPVATGDQSVRSGGLALP Q25657 110 3 -
FLRPVATGDQKLKDGGFAFP O61130 110 3 -
FLTPVATGAQRLKEGGFAFP PK66_PLAKU 110 3 -

Motif 5 width=22
Element Seqn Id St Int Rpt
LDELTLCSRHAGNMIPDNDKNS Q94661 211 26 -
LDELTLCSRHAGNMIPDNDKNS AMA1_PLAFF 211 26 -
LDELTLCSRHAGNMNPDKDENS AMA1_PLAFC 211 26 -
LDELTLCSRHAGNMNPDNDKNS AMA1_PLAFG 211 26 -
LDELTLCSRHAGNMNPDNDKNS AMA1_PLAFH 211 26 -
LDELTLCSRHAGNMNPDNDKNS AMA1_PLAF8 211 26 -
LNDMSLCAKHASFFVPGNNANS Q25687 156 26 -
LNDMSLCAKHASFYVPGTNVNT AMA1_PLACH 156 26 -
LNDLALCKTHAASFVMEMDKNS AMA1_PLAFR 156 26 -
LNDMSLCAKHTSFYVPGKDAKS Q26225 156 26 -
LNDMSLCAKHTSLYVPGKDATS Q26224 156 26 -
LNNMSLCAKHTSFYVPGNNANS Q25657 156 26 -
LNDIALCRTHAASFVMAGDQNS O61130 156 26 -
LNDIALCKTHAASFVIAEDQNT PK66_PLAKU 156 26 -

Motif 6 width=24
Element Seqn Id St Int Rpt
YKYPAVYDDKDKKCHILYIAAQEN Q94661 234 1 -
YKYPAVYDDKDKKCHILYIAAQEN AMA1_PLAFF 234 1 -
YKYPAVYDDKDKKCHILYIAAQEN AMA1_PLAFC 234 1 -
YKYPAVYDYNDKKCHILYIAAQEN AMA1_PLAFG 234 1 -
YKYPAVYDYEDKKCHILYIAAQEN AMA1_PLAFH 234 1 -
YKYPAVYDYNDKKCHILYIAAQEN AMA1_PLAF8 234 1 -
YRHPAVYDKHNKTCYILYVAAQEN Q25687 179 1 -
YRHPAVYDKSNKTCYILYVAAQEN AMA1_PLACH 179 1 -
YRHPAVYDEDKKICYMLYLSAQEN AMA1_PLAFR 179 1 -
YRHPAVYDKSDSTCYMLYVAAQEN Q26225 179 1 -
YRHPVVYDKSNSTCYMLYVAAQEN Q26224 179 1 -
YRHPAVYDKSNSTCYMLYVAAQEN Q25657 179 1 -
YRHPAVYDEKEKTCHMLYLSAQEN O61130 179 1 -
YRHPAVYDEKNKTCYMLYLSAQEN PK66_PLAKU 179 1 -

Motif 7 width=20
Element Seqn Id St Int Rpt
GPRYCNKDESKRNSMFCFRP Q94661 259 1 -
GPRYCNKDESKRNSMFCFRP AMA1_PLAFF 259 1 -
GPRYCNKDESKRNSMFCFRP AMA1_PLAFC 259 1 -
GPRYCNKDQSKRNSMFCFRP AMA1_PLAFG 259 1 -
GPRYCNKDESKRNSMFCFRP AMA1_PLAFH 259 1 -
GPRYCNKDESKRNSMFCFRP AMA1_PLAF8 259 1 -
GPRYCSNEENNENQPFCFTP Q25687 204 1 -
GPRYCSNEEDNENQPFCFTP AMA1_PLACH 204 1 -
GPRYCSKDAENKDAMFCFKP AMA1_PLAFR 204 1 -
GPRYCSNDANNENQPFCFTP Q26225 204 1 -
GPRYCSNDANNENQPFCFTP Q26224 204 1 -
GPRYCSNNANNDNQPFCFTP Q25657 204 1 -
GPRYCSPDAQNRDAVFCFKP O61130 204 1 -
GPRYCSPDSQNKDAMFCFKP PK66_PLAKU 204 1 -

Motif 8 width=30
Element Seqn Id St Int Rpt
YLSKNVVDNWEKVCPRKNLQNAKFGLWVDG Q94661 289 10 -
YLSKNVVDNWEKVCPRKNLQNAKFGLWVDG AMA1_PLAFF 289 10 -
YLSKNVVDNWEKVCPRKNLENAKFGLWVDG AMA1_PLAFC 289 10 -
YLSKNVVDNWEEVCPRKNLENAKFGLWVDG AMA1_PLAFG 289 10 -
YLSKNVVDNWEEVCPRKNLENAKFGLWVDG AMA1_PLAFH 289 10 -
YLSKNVVDNWEKVCPRKNLENAKFGLWVDG AMA1_PLAF8 289 10 -
YLTKNLREDWETSCPNKSIQNAKFGVWVDG Q25687 234 10 -
YLTKNLREDWETSCPNKSIQNAKFGVWVDG AMA1_PLACH 234 10 -
YLSKNVVNDWQNKCPRKNLGNSKFGLWVDG AMA1_PLAFR 234 10 -
YLTKNLRDDWETSCPNKSIRNAKFGIWVDG Q26225 234 10 -
YLTKNLRDDWETSCPNKSIKNAKFGIWVDG Q26224 234 10 -
YLTKNLRDDWETSCPNKSIKNAKFGIWVDG Q25657 234 10 -
YLSKNVRNDWDKKCPRKNLGNAKFGLWVDG O61130 234 10 -
YLSKNVSNDWENKCPRKNLGNAKFGLWVDG PK66_PLAKU 234 10 -

Motif 9 width=19
Element Seqn Id St Int Rpt
ECNKLVFELSASDQPKQYE Q94661 336 17 -
ECNKLVFELSASDQPKQYE AMA1_PLAFF 336 17 -
ECNKLVFELSASDQPKQYE AMA1_PLAFC 336 17 -
ECNKLVFELSASDQPKQYE AMA1_PLAFG 336 17 -
ECNKLVFELSASDQPKQYE AMA1_PLAFH 336 17 -
ECNKLVFELSASDQPKQYE AMA1_PLAF8 336 17 -
ECNRIVFDESASDQPKQYE Q25687 281 17 -
ECNQIVFNESASDQPKQYE AMA1_PLACH 281 17 -
ECNRIVFEASASDQPTQYE AMA1_PLAFR 281 17 -
ACNQIIFNESASDQPKQYE Q26225 281 17 -
KCNQIIFNESASDQPKQYE Q26224 281 17 -
KCNQIIFNESASDQPKQYE Q25657 281 17 -
ECNRIVFGASASDQPTQYE O61130 281 17 -
ECNRIVFEASASDQPRQYE PK66_PLAKU 281 17 -

Motif 10 width=23
Element Seqn Id St Int Rpt
LPTGAFKADRYKSHGKGYNWGNY Q94661 380 25 -
LPTGAFKADRYKSHGKGYNWGNY AMA1_PLAFF 380 25 -
LPTGAFKADRYKSHGKGYNWGNY AMA1_PLAFC 380 25 -
LPTGAFKADRYKSHGKGYNWGNY AMA1_PLAFG 380 25 -
LPTGAFKADRYKSRGKGYNWGNY AMA1_PLAFH 380 25 -
LPTGAFKADRYKSRGKGYNWGNY AMA1_PLAF8 380 25 -
LPIGSYRADQVKSKGKGYNWANY Q25687 325 25 -
LPIGSYRADQVKSKGKGYNWANY AMA1_PLACH 325 25 -
LPVGAFNSDNFKSKGRGYNWANF AMA1_PLAFR 325 25 -
LPIGSYKSGQIKSHGKGYNWGNY Q26225 325 25 -
LPIGSYKSGQIKSHGKGYNWGNY Q26224 325 25 -
LPIGSYKSDQIKSHGRGYNWGNY Q25657 325 25 -
LPVGAFNSDNFKSKGRGFNWANF O61130 325 25 -
LPVGAFNSDNFKSKGRGYNWANF PK66_PLAKU 325 25 -

Motif 11 width=29
Element Seqn Id St Int Rpt
CEIFNVKPTCLINNSSYIATTALSHPIEV Q94661 409 6 -
CEIFNVKPTCLINNSSYIATTALSHPIEV AMA1_PLAFF 409 6 -
CEIFNVKPTCLINNSSYIATTALSHPIEV AMA1_PLAFC 409 6 -
CEIFNVKPTCLINNSSYIATTALSHPIEV AMA1_PLAFG 409 6 -
CEIFNVKPTCLINNSSYIATTALSHPNEV AMA1_PLAFH 409 6 -
CEIFNVKPTCLINNSSYIATTALSHPNEV AMA1_PLAF8 409 6 -
CYIFNKKPTCLINDKNFVATTALSSLEEA Q25687 354 6 -
CYIFNKKPTCLINDKDFVATTALSSLEEG AMA1_PLACH 354 6 -
CYLFNAKPTCLINDKNFIATTALSHPQEV AMA1_PLAFR 354 6 -
CYIFETKPTCLINDKNFIATTALSSTEEF Q26225 354 6 -
CYIFETKPTCLINDKNFIATTALSSTEEF Q26224 354 6 -
CYIFETKPTCLINDRNFIATTALSSTEEF Q25657 354 6 -
CYIFNTKPTCLINDKNFIATTALSHPQEV O61130 354 6 -
CYIFNTKPTCLINDKNFFATTALSHPQEV PK66_PLAKU 354 6 -

Motif 12 width=18
Element Seqn Id St Int Rpt
PRIFISDDKDSLKCPCDP Q94661 477 39 -
PRIFISDDKDSLKCPCDP AMA1_PLAFF 477 39 -
PRIFISDDKDSLKCPCDP AMA1_PLAFC 477 39 -
PRIFISDDKDSLKCPCDP AMA1_PLAFG 477 39 -
PRIFISDDKDSLKCPCDP AMA1_PLAFH 477 39 -
PRIFISDDIDSLKCPCDP AMA1_PLAF8 477 39 -
PRIFISDDKESLKCPCEP Q25687 418 35 -
PRIFISDDKESLNCPCEP AMA1_PLACH 418 35 -
PRIFISNDKDSLKCPCAP AMA1_PLAFR 419 36 -
PRIFISSDKNSLNCPCEP Q26225 418 35 -
PRIFISTDKNSLNCPCDP Q26224 418 35 -
PRIFISTDKNSLNCPCEP Q25657 416 33 -
PRIFISNDKESIKCPCEP O61130 419 36 -
PRIFISTDKESIKCPCEP PK66_PLAKU 419 36 -

Motif 13 width=28
Element Seqn Id St Int Rpt
CRFFVCKCVERRAEVTSNNEVVVKEEYK Q94661 502 7 -
CNFFVCKCVERRAEVTSNNEVVVKEEYK AMA1_PLAFF 502 7 -
CRFFVCKCVERRAEVTSNNEVVVKEEYK AMA1_PLAFC 502 7 -
CRFFVCKCVERRAEVTSNNEVVVKEEYK AMA1_PLAFG 502 7 -
CNFFVCKCVEKRAEVTSNNEVVVKEEYK AMA1_PLAFH 502 7 -
CNFFVCKCVEKRAEVTSNNEVVVKEEYK AMA1_PLAF8 502 7 -
CNFFVCNCVEKRQFISENNEVEIKDEFK Q25687 443 7 -
CKFFVCNCVEKRQFISENNEVEIKDEFK AMA1_PLACH 443 7 -
CNFYVCNCVEKRAEIKENNEVAIKEEFK AMA1_PLAFR 444 7 -
CDFYVCSCVEQRQYIAENNDVIIKEEFI Q26225 443 7 -
CEFYVCSCVEQRQYIAENNDVIIKEEFI Q26224 443 7 -
CNFYVCNCVEKRQYIAENNDVEIKEELE Q25657 441 7 -
CNFYVCNCVEKRAEIKENNQVVIKEEFR O61130 444 7 -
CNFYVCNCVEKRAEIKENNEVIIKEEFK PK66_PLAKU 444 7 -

Motif 14 width=21
Element Seqn Id St Int Rpt
YDKMDEPQDYGKSNSRNDEML Q94661 576 46 -
YDKMDEPQHYGKSNSRNDEML AMA1_PLAFF 576 46 -
YDKMDQPQDYGKSTSRNDEML AMA1_PLAFC 576 46 -
YDKMDQPQHYGKSTSRNDEML AMA1_PLAFG 576 46 -
YDKMDEPQDYGKSTSRNDEML AMA1_PLAFH 576 46 -
YDKMDEPQDYGKSNSRNDEML AMA1_PLAF8 576 46 -
YDKMGQADTYGKAQSRKDEML Q25687 512 41 -
YDKMGQADTYGKAQSRKDEML AMA1_PLACH 512 41 -
YDKMEQADGYGKPTTRKDEML AMA1_PLAFR 516 44 -
YDRMGQADDYGKSKSRKDEML Q26225 511 40 -
YDRMGQADDYGKSKSRKDEML Q26224 511 40 -
YDRMGQADIYGKANSRKDGML Q25657 510 41 -
YDKMDQAEGYGKPTTRKDEML O61130 516 44 -
YDKMDQAEAYGKTANTRKDEM PK66_PLAKU 516 44 -

Motif 15 width=25
Element Seqn Id St Int Rpt
DPEASFWGEEKRASHTTPVLMEKPY Q94661 597 0 -
DPEASFWGEEKRASHTTPVLMEKPY AMA1_PLAFF 597 0 -
DPEASFWGEEKRASHTTPVLMEKPY AMA1_PLAFC 597 0 -
DPEASFWGEEKRASHTTPVLMEKPY AMA1_PLAFG 597 0 -
DPEASFWGEEKRASHTTPVLMEKPY AMA1_PLAFH 597 0 -
DPEASFWGEEKRASHTTPVLMEKPY AMA1_PLAF8 597 0 -
DPEVSFWGEDKRASHTTPVLMEKPY Q25687 533 0 -
DPEVSFWGEDKRASHTTPVLMEKPY AMA1_PLACH 533 0 -
DPEASFWGEEKRASHTTPVLMEKPY AMA1_PLAFR 537 0 -
DPEVSFWGEDKRASHTTPVLMEKPY Q26225 532 0 -
DPEVSFWGEDKRASHTTPVLMEKPY Q26224 532 0 -
DPEVSFWGEDKRASHTTPVLMEKPY Q25657 531 0 -
DPEASFWGEDKRASHTTPVLMEKPY O61130 537 0 -
DPEASFWGEDKRASHTTPVLMEKPY PK66_PLAKU 538 1 -