SPRINT Home UMBER Home Contents Standard Search Advanced Search Relation Search

==SPRINT==> PRINTS View



  selected as


PR01240

Identifier
FILOVP35  [View Relations]  [View Alignment]  
Accession
PR01240
No. of Motifs
8
Creation Date
05-NOV-1999
Title
Filoviridae VP35 signature
Database References

PRODOM; PD011653
INTERPRO; IPR002953
Literature References
1. KLENK, H-D., SLENCZKA, W. AND FELDMANN, H.
Marburg and ebola viruses.
http://www.bocklabs.wisc.edu/eov-ebola.html
 
2. PETERS, C.J., SANCHEZ, A., ROLLIN, P.E., KSIAZEK, T.G. AND MURPHY, F.A.
Filoviridae: Marburg and Ebola Viruses.
IN FIELDS VIROLOGY, 3RD ED., VOL.1, 1996, B.N.FIELDS, D.N.KNIPE AND 
P.M.HOWLEY EDS., PP.1161-1167.
 
3. BUKREYEV, A.A., VOLCHKOV, V.E., BLINOV, V.M. AND NETESOV, S.V.
The VP35 and VP40 proteins of filoviruses. Homology between Marburg and 
Ebola viruses.
FEBS LETT. 322(1) 41-46 (1993).

Documentation
The filoviridae are a group of viruses that cause haemorrhagic fevers with
a high mortality rate. The family currently contains three viruses: Ebola, 
Marburg and Reston, named after their corresponding outbreak regions [1]. 
They possess negative-stranded RNA genomes, which encode at least 7 proteins.
The VP35 protein is found in the genomes of all filoviruses. Its function is 
presently unknown, but it is thought to share the function of the 
phosphorylated proteins (polymerase subunits) of rhabdoviruses and 
paramyxoviruses due to its position in the genome. There is no evidence 
however, to suggest that VP35 is phosphorylated [2,3].
 
FILOVP35 is an 8-element fingerprint that provides a signature for the
filovirus VP35 proteins. The fingerprint was derived from an initial 
alignment of 3 sequences: the motifs were drawn from short conserved regions
spanning the full alignment length. Two iterations on SPTR37_10f were
required to reach convergence, at which point a true set comprising 6 
sequences was identified.
Summary Information
6 codes involving  8 elements
0 codes involving 7 elements
0 codes involving 6 elements
0 codes involving 5 elements
0 codes involving 4 elements
0 codes involving 3 elements
0 codes involving 2 elements
Composite Feature Index
866666666
700000000
600000000
500000000
400000000
300000000
200000000
12345678
True Positives
O36425        O36426        O36427        VP35_EBOV     
VP35_MABVM VP35_MABVP
Sequence Titles
O36425      VP35 - MARBURG VIRUS.                         
O36426 VP35 - MARBURG VIRUS.
O36427 VP35 - MARBURG VIRUS.
VP35_EBOV POLYMERASE COMPLEX PROTEIN VP35 - EBOLA VIRUS (EBO).
VP35_MABVM POLYMERASE COMPLEX PROTEIN VP35 - MARBURG VIRUS (STRAIN MUSOKE).
VP35_MABVP POLYMERASE COMPLEX PROTEIN VP35 (VP2) - MARBURG VIRUS (STRAIN POPP).
Scan History
SPTR37_10f 2  30   NSINGLE    
Initial Motifs
Motif 1  width=26
Element Seqn Id St Int Rpt
MWDSSYMQQVSEGLMTGKVPIDQVFG VP35_MABVP 1 1 -
MWDSSYMQQVSEGLMTGKVPIDQVFG VP35_MABVM 1 1 -
MPGPELSGWISEQLMTGRIPVSDIFC VP35_EBOV 20 20 -

Motif 2 width=30
Element Seqn Id St Int Rpt
MGRTLEAISKGMSEMLAKYDHLVISTGRTT VP35_MABVP 113 86 -
MGRTLEAISKGMSEMLAKYDHLVISTGRTT VP35_MABVM 113 86 -
MAKTISSLNRVCAEMVAKYDLLVMTTGRAT VP35_EBOV 124 78 -

Motif 3 width=30
Element Seqn Id St Int Rpt
FDAYLNEHGVPPPQPAIFKDLGVAQQACSK VP35_MABVP 148 5 -
FDAYLNEHGVPPPQPAIFKDLGVAQQACSK VP35_MABVM 148 5 -
TEAYWAEHGQPPPGPSLYEESAIRGKIESR VP35_EBOV 159 5 -

Motif 4 width=20
Element Seqn Id St Int Rpt
KVLELSEETFSKPNLSAKDL VP35_MABVP 194 16 -
KVLELSEETFSKPNLSAKDL VP35_MABVM 194 16 -
STTSLTEENFGKPDISAKDL VP35_EBOV 205 16 -

Motif 5 width=20
Element Seqn Id St Int Rpt
LLFTHLPGNNTPFHILAQVL VP35_MABVP 216 2 -
LLFTHLPGNNTPFHILAQVL VP35_MABVM 216 2 -
IMYDHLPGFGTAFHQLVQVI VP35_EBOV 227 2 -

Motif 6 width=30
Element Seqn Id St Int Rpt
EGENAQAALTRLSRTFDAFLGVVPPVIRVK VP35_MABVP 258 22 -
EGENAQAALTRLSRTFDAFLGVVPPVIRVK VP35_MABVM 258 22 -
EGDSPQCALIQITKRVPIFQDAAPPVIHIR VP35_EBOV 269 22 -

Motif 7 width=17
Element Seqn Id St Int Rpt
VPRPCQKSLRAVPPNPT VP35_MABVP 292 4 -
VPRPSQKSLRAVPPNPT VP35_MABVM 292 4 -
IPRACQKSLRPVPPSPK VP35_EBOV 303 4 -

Motif 8 width=21
Element Seqn Id St Int Rpt
IDKGWVCVYSSEQGETRALKI VP35_MABVP 309 0 -
IDKGWVCVYSSEQGETRALKI VP35_MABVM 309 0 -
IDRGWVCVFQLQDGKTLGLKI VP35_EBOV 320 0 -
Final Motifs
Motif 1  width=26
Element Seqn Id St Int Rpt
MWDSSYMQQVSEGLMTGKVPIDQVFG O36425 1 1 -
MWDSSYMQQVSEGLMTGKVPIDQVFG VP35_MABVP 1 1 -
MWDSSYMQQVSEGLMTGKVPIDQVFG O36427 1 1 -
MWDSSYMQQVSEGLMTGKVPIDQVFG VP35_MABVM 1 1 -
MWDSSYMQQVSEGLMTGKVPIDQVFG O36426 1 1 -
MPGPELSGWISEQLMTGRIPVSDIFC VP35_EBOV 20 20 -

Motif 2 width=30
Element Seqn Id St Int Rpt
MGRTLEAISKGMSEMLAKYDHLVISTGRTT O36425 113 86 -
MGRTLEAISKGMSEMLAKYDHLVISTGRTT VP35_MABVP 113 86 -
MGRTLEAISKGMSEMLAKYDHLVISTGRTT O36427 113 86 -
MGRTLEAISKGMSEMLAKYDHLVISTGRTT VP35_MABVM 113 86 -
MGKTLEAISKGMSEMLAKYDHLVISTGRTT O36426 113 86 -
MAKTISSLNRVCAEMVAKYDLLVMTTGRAT VP35_EBOV 124 78 -

Motif 3 width=30
Element Seqn Id St Int Rpt
FDAYLNEHGVPPPQPAIFKDLGVAQQACSK O36425 148 5 -
FDAYLNEHGVPPPQPAIFKDLGVAQQACSK VP35_MABVP 148 5 -
FDAYLNEHGVPPPQPAIFKDLGVAQQACSK O36427 148 5 -
FDAYLNEHGVPPPQPAIFKDLGVAQQACSK VP35_MABVM 148 5 -
FDAYLNEHGVPPPQPAIFKDLGVAQQAYSQ O36426 148 5 -
TEAYWAEHGQPPPGPSLYEESAIRGKIESR VP35_EBOV 159 5 -

Motif 4 width=20
Element Seqn Id St Int Rpt
KVLELSEETFSKPNLSAKDL O36425 194 16 -
KVLELSEETFSKPNLSAKDL VP35_MABVP 194 16 -
KVLELSEETFSKPNLSAKDL O36427 194 16 -
KVLELSEETFSKPNLSAKDL VP35_MABVM 194 16 -
KVLELSEETFSKPNLSAKDL O36426 194 16 -
STTSLTEENFGKPDISAKDL VP35_EBOV 205 16 -

Motif 5 width=20
Element Seqn Id St Int Rpt
LLFTHLPGNNTPFHILAQVL O36425 216 2 -
LLFTHLPGNNTPFHILAQVL VP35_MABVP 216 2 -
LLFTHLPGNNTPFHILAQVL O36427 216 2 -
LLFTHLPGNNTPFHILAQVL VP35_MABVM 216 2 -
LLFTHLPGNNTPFHILAQVL O36426 216 2 -
IMYDHLPGFGTAFHQLVQVI VP35_EBOV 227 2 -

Motif 6 width=30
Element Seqn Id St Int Rpt
EGENAQAALTRLSRTFDAFLGVVPPVIRVK O36425 258 22 -
EGENAQAALTRLSRTFDAFLGVVPPVIRVK VP35_MABVP 258 22 -
EGENAQAALTRLSRTFDAFLGVVPPVIRVK O36427 258 22 -
EGENAQAALTRLSRTFDAFLGVVPPVIRVK VP35_MABVM 258 22 -
EGENAQAALTRLSRTFDAFLGAVPPVIKVK O36426 258 22 -
EGDSPQCALIQITKRVPIFQDAAPPVIHIR VP35_EBOV 269 22 -

Motif 7 width=17
Element Seqn Id St Int Rpt
VPRPCQKSLRAVPPNPT O36425 292 4 -
VPRPCQKSLRAVPPNPT VP35_MABVP 292 4 -
VPRPCQKSLRAVPPNPT O36427 292 4 -
VPRPSQKSLRAVPPNPT VP35_MABVM 292 4 -
VPRPCQKSLRAVPPNPT O36426 292 4 -
IPRACQKSLRPVPPSPK VP35_EBOV 303 4 -

Motif 8 width=21
Element Seqn Id St Int Rpt
IDKGWVCVYSSEQGETRALKI O36425 309 0 -
IDKGWVCVYSSEQGETRALKI VP35_MABVP 309 0 -
IDKGWVCVYSSEQGETRALKI O36427 309 0 -
IDKGWVCVYSSEQGETRALKI VP35_MABVM 309 0 -
IDKGWVCVYSSEQGETRALKI O36426 309 0 -
IDRGWVCVFQLQDGKTLGLKI VP35_EBOV 320 0 -