SPRINT Home UMBER Home Contents Standard Search Advanced Search Relation Search

==SPRINT==> PRINTS View



  selected as


PR00878

Identifier
CHOLNESTRASE  [View Relations]  [View Alignment]  
Accession
PR00878
No. of Motifs
6
Creation Date
27-JUN-1998  (UPDATE 07-JUN-1999)
Title
Cholinesterase signature
Database References
PRINTS; PR00879 ACHEFISH; PR00880 ACHEINSECT
PROSITE; PS00122 CARBOXYLESTERASE_B_1; PS00941 CARBOXYLESTERASE_B_2
BLOCKS; BL00122
INTERPRO; IPR000997
PDB; 2ACE
SCOP; 2ACE
CATH; 2ACE
Literature References
1. VOET, D. AND VOET, J.G.
Biochemical communications: Hormones and neurotransmission.
BIOCHEMISTRY 34-4 1298-1299 (1995).
 
2. COUSIN, X., HOTELIER, T., GILES, K., TOUTANT, J.P. AND CHATONNET, A.
aCHEdb: the database system for ESTHER, the a/b fold family of proteins and
the Cholinesterase gene server.
NUCLEIC ACIDS RES. 26 226-228 (1998).
 
3. THE ESTHER DATABASE
http://meleze.ensam.inra.fr/cholinesterase/definitions.html
 
4. CHOLINESTERASES
http://bnlstb.bio.bnl.gov:8000/disk$3/giles/che.html

Documentation
Group B carboxylesterases constitute a family of enzymes that includes
proteins that catalyse the conversion of an acylcholine to a choline and
a weak acid:
	    Acylcholine + H(2)O -> Choline + COO(-)
 
and those that catalyse the hydrolysis of acetylcholine to choline and 
acetate (acetylcholinesterases):
 
           Acetylcholine + H(2)O -> Choline + Acetate 
 	     
Acetylcholinesterase also acts on a variety of acetic esters and catalyses
transacetylations. It is found in, or attached to, cellular or basement
membranes of presynaptic cholinergic neurons and postsynaptic cholinoceptive
cells. To prevent continuous firing of nerve impulses, acetylcholinesterase 
has a high K(cat) (~14000/s), to ensure that acetylcholine is broken down
quickly.
 
Cholinesterases themselves constitute a family of enzymes that fall into 
two main types, depending on their substrate preference: enzymes that 
preferentially hydrolyse acetyl esters are termed acetylcholinesterase
(AChE) (EC 3.1.1.7); and those that prefer other types of ester, such as
butyrylcholine are termed butyrylcholinesterase (BChE) (EC 3.1.1.8). 
 
The 3D structure of acetylcholinesterase from the electric ray has been
determined. The fold belongs to the alpha/beta class, with a 3-layer
alpha-beta-alpha sandwich architecture.
 
CHOLNESTRASE is a 6-element fingerprint that provides a signature for the
cholinesterase family. The fingerprint was derived from an initial alignment
of 18 sequences: the motifs were drawn from short conserved sections 
spanning virtually the full alignment length - motif 1 includes helix 2;
motif 2 spans the N-terminus of strand 7, helices 3 and 4, and the
N-terminus of strand 8; motif 3 includes helix 15; motif 4 spans the
C-terminus of helix 18 and the N-terminus of helix 19, which includes a
Cys residue involved in disulphide bond formation; motif 5 encodes helix 20;
and motif 6 spans helices 21 and 22. Two iterations on OWL30.1 were required
to reach convergence, at which point a true set comprising 23 sequences was
identified. Several partial matches were also found, two of which are foetal
proteins, and the rest are fragments.
 
An update on SPTR37_9f identified a true set of 26 sequences, and 1
partial match.
Summary Information
  26 codes involving  6 elements
1 codes involving 5 elements
0 codes involving 4 elements
0 codes involving 3 elements
0 codes involving 2 elements
Composite Feature Index
6262626262626
5110111
4000000
3000000
2000000
123456
True Positives
ACE1_CAEBR    ACE1_CAEEL    ACES_ANOST    ACES_BOVIN    
ACES_BUNFA ACES_CHICK ACES_DROME ACES_HUMAN
ACES_LEPDE ACES_MOUSE ACES_RAT ACES_TORCA
ACES_TORMA CHLE_HUMAN CHLE_MOUSE CHLE_RABIT
O42275 O45210 O61987 O62760
O62761 O62762 O62763 O76998
O76999 P91954
True Positive Partials
Codes involving 5 elements
O61372
Sequence Titles
ACE1_CAEBR  ACETYLCHOLINESTERASE 1 PRECURSOR (EC 3.1.1.7) (ACHE) - CAENORHABDITIS BRIGGSAE. 
ACE1_CAEEL ACETYLCHOLINESTERASE 1 PRECURSOR (EC 3.1.1.7) (ACHE) - CAENORHABDITIS ELEGANS.
ACES_ANOST ACETYLCHOLINESTERASE PRECURSOR (EC 3.1.1.7) - ANOPHELES STEPHENSI (INDO-PAKISTAN MALARIA MOSQUITO).
ACES_BOVIN ACETYLCHOLINESTERASE (EC 3.1.1.7) - BOS TAURUS (BOVINE).
ACES_BUNFA ACETYLCHOLINESTERASE PRECURSOR (EC 3.1.1.7) - BUNGARUS FASCIATUS (BANDED KRAIT).
ACES_CHICK ACETYLCHOLINESTERASE PRECURSOR (EC 3.1.1.7) - GALLUS GALLUS (CHICKEN).
ACES_DROME ACETYLCHOLINESTERASE PRECURSOR (EC 3.1.1.7) (ACHE) - DROSOPHILA MELANOGASTER (FRUIT FLY).
ACES_HUMAN ACETYLCHOLINESTERASE PRECURSOR (EC 3.1.1.7) - HOMO SAPIENS (HUMAN).
ACES_LEPDE ACETYLCHOLINESTERASE PRECURSOR (EC 3.1.1.7) - LEPTINOTARSA DECEMLINEATA (COLORADO POTATO BEETLE).
ACES_MOUSE ACETYLCHOLINESTERASE PRECURSOR (EC 3.1.1.7) - MUS MUSCULUS (MOUSE).
ACES_RAT ACETYLCHOLINESTERASE PRECURSOR (EC 3.1.1.7) - RATTUS NORVEGICUS (RAT).
ACES_TORCA ACETYLCHOLINESTERASE PRECURSOR (EC 3.1.1.7) (ACHE) - TORPEDO CALIFORNICA (PACIFIC ELECTRIC RAY).
ACES_TORMA ACETYLCHOLINESTERASE PRECURSOR (EC 3.1.1.7) (ACHE) - TORPEDO MARMORATA (MARBLED ELECTRIC RAY).
CHLE_HUMAN CHOLINESTERASE PRECURSOR (EC 3.1.1.8) (ACYLCHOLINE ACYLHYDROLASE) (CHOLINE ESTERASE II) (BUTYRYLCHOLINE ESTERASE) (PSEUDOCHOLINESTERASE) - HOMO SAPIENS (HUMAN).
CHLE_MOUSE CHOLINESTERASE PRECURSOR (EC 3.1.1.8) (ACYLCHOLINE ACYLHYDROLASE) (CHOLINE ESTERASE II) (BUTYRYLCHOLINE ESTERASE) (PSEUDOCHOLINESTERASE) - MUS MUSCULUS (MOUSE).
CHLE_RABIT CHOLINESTERASE PRECURSOR (EC 3.1.1.8) (ACYLCHOLINE ACYLHYDROLASE) (CHOLINE ESTERASE II) (BUTYRYLCHOLINE ESTERASE) (PSEUDOCHOLINESTERASE) - ORYCTOLAGUS CUNICULUS (RABBIT).
O42275 ACETYLCHOLINESTERASE CATALYTIC SUBUNIT PRECURSOR (EC 3.1.1.7) - ELECTROPHORUS ELECTRICUS (ELECTRIC EEL).
O45210 ACETYLCHOLINESTERASE PRECURSOR (EC 3.1.1.7) (TRUE CHOLINESTERASE) (CHOLINE ESTERASE I) - BOOPHILUS MICROPLUS (CATTLE TICK).
O61987 ACETYLCHOLINESTERASE PRECURSOR (EC 3.1.1.7) - BOOPHILUS DECOLORATUS.
O62760 BUTYRYLCHOLINESTERASE PRECURSOR - FELIS SILVESTRIS CATUS (CAT).
O62761 BUTYRYLCHOLINESTERASE PRECURSOR - PANTHERA TIGRIS TIGRIS.
O62762 ACETYLCHOLINESTERASE GLYCOPHOSPHOLIPID-ANCHORED FORM PRECURSOR - FELIS SILVESTRIS CATUS (CAT).
O62763 ACETYLCHOLINESTERASE COLLAGEN-TAILED OR GLOBULAR FORM PRECURSOR - FELIS SILVESTRIS CATUS (CAT).
O76998 CHOLINESTERASE 1 (EC 3.1.1.7) - BRANCHIOSTOMA FLORIDAE (FLORIDA LANCELET) (AMPHIOXUS).
O76999 CHOLINESTERASE 2 (EC 3.1.1.7) - BRANCHIOSTOMA FLORIDAE (FLORIDA LANCELET) (AMPHIOXUS).
P91954 ACETYLCHOLINESTERASE - LUCILIA CUPRINA (GREENBOTTLE FLY) (AUSTRALIAN SHEEP BLOWFLY).

O61372 ACETYLCHOLINESTERASE (EC 3.1.1.7) - CAENORHABDITIS ELEGANS.
Scan History
OWL30_1    2  50   NSINGLE    
SPTR37_9f 2 53 NSINGLE
Initial Motifs
Motif 1  width=15
Element Seqn Id St Int Rpt
DEQFPGFSGSEMWNP ACES_TORCA 93 93 -
DEQFPGFPGSEMWNP ACES_TORMA 96 96 -
DTTFPGFQGSEMWNP ACES_CHICK 99 99 -
DTSYPGFQGTEMWNP ACES_BUNFA 103 103 -
DQAFPGFQGSEMWNP CHLE_MOUSE 99 99 -
YEYFPGFEGEEMWNP ACES_LEPDE 108 108 -
YEYFPGFAGEEMWNP ACES_ANOST 100 100 -
YEYFPGFSGEEIWNP ACES_DROME 109 109 -
DTYFGDFYGSTMWNP ACE1_CAEBR 87 87 -
DTYFGDFYGSTMWNA ACE1_CAEEL 87 87 -
YEYFPGFAGEEMWNP S66236 99 99 -
DTLYPGFEGTEMWNP ACES_RABIT 75 75 -
DTLYPGFEGTEMWNP ACES_BOVIN 74 74 -
DTLYPGFEGTEMWNP ACES_RAT 105 105 -
DTLYPGFEGTEMWNP ACES_MOUSE 105 105 -
DQSFPGFHGSEMWNP CHLE_HUMAN 98 98 -
DTLYPGFEGTEMWNP ACES_HUMAN 105 105 -
DQSFPGFHGSEMWNP CHLE_RABIT 77 77 -

Motif 2 width=30
Element Seqn Id St Int Rpt
YGGGFYSGSSTLDVYNGKYLAYTEEVVLVS ACES_TORMA 140 29 -
YGGGFYSGAASLDVYDGRFLTYTQNVILVS ACES_BUNFA 147 29 -
YGGGFQTGTSSLPVYDGKFLARVERVIVVS CHLE_MOUSE 143 29 -
YGGGFYSGASSLDVYYGRFLVQAEGTVLVA ACES_RABIT 120 30 -
YGGGFMSGTSTLDVYNAEMLAAVGNVIVAS S66236 171 57 -
YGGGFWSGTATLDVYDGRILTVEENVILVA ACE1_CAEEL 133 31 -
YGGGFWSGTSTLDVYDGRILTVEENVILVA ACE1_CAEBR 133 31 -
YGGGFMTGSATLDIYNADIMAAVGNVIVAS ACES_DROME 186 62 -
YGGGFMSGTSTLDIYNAEILAAVGNVIVAS ACES_ANOST 172 57 -
YGGGYMSGTATLDVYDADIIAATSDVIVAS ACES_LEPDE 164 41 -
YGGGFYSGASSLDVYDGRFLVQAEGTVLVS ACES_BOVIN 119 30 -
YGGGFYSGASSLDVYDGRFLAQVEGTVLVS ACES_RAT 150 30 -
YGGGFYSGAASLDVYDGRFLAQVEGAVLVS ACES_MOUSE 150 30 -
YGGGFQTGTSSLHVYDGKFLARVERVIVVS CHLE_HUMAN 142 29 -
YGGGFYSGASSLDVYDGRFLVQAERTVLVS ACES_HUMAN 150 30 -
YGGGFQTGTSSLQVYDGKFLTRVERVIVVS CHLE_RABIT 121 29 -
YGGGFYSGSSTLDVYNGKYLAYTEEVVLVS ACES_TORCA 137 29 -
YGGGFTGGSVSLDVYDGRYLAAAEEAVVVS ACES_CHICK 143 29 -

Motif 3 width=9
Element Seqn Id St Int Rpt
GTAFLVYGA CHLE_MOUSE 355 182 -
GTYFLLYDF S66236 388 187 -
GTYFLVYGA ACES_RABIT 336 186 -
GSYFLVYGA ACES_BOVIN 335 186 -
GSYFLVYGV ACES_RAT 366 186 -
GSYFLVYGV ACES_MOUSE 366 186 -
GTAFLVYGA CHLE_HUMAN 354 182 -
GSYFLVYGA ACES_HUMAN 366 186 -
GTAFLVYGA CHLE_RABIT 333 182 -
GSFFLLYGA ACES_TORCA 349 182 -
GSFFLLYGA ACES_TORMA 352 182 -
GSYFLVYGV ACES_CHICK 521 348 -
GSYFLIYGL ACES_BUNFA 359 182 -
GTYFLLYDF ACES_LEPDE 383 189 -
GTYFLLYDF ACES_ANOST 391 189 -
GTYFLLYDF ACES_DROME 406 190 -
SIYFLTYQL ACE1_CAEBR 347 184 -
SIYFLTYQL ACE1_CAEEL 347 184 -

Motif 4 width=9
Element Seqn Id St Int Rpt
AVGDHFFIC ACES_ANOST 458 58 -
VVGDHNVVC ACES_RABIT 402 57 -
SVGDHFFIC S66236 455 58 -
MLGDYHFTC ACE1_CAEEL 422 66 -
MLGDYHFTC ACE1_CAEBR 422 66 -
AVGDHFFTC ACES_DROME 472 57 -
VVGDHNVVC ACES_BOVIN 401 57 -
VVGDHNVVC ACES_RAT 432 57 -
VVGDHNVVC ACES_MOUSE 432 57 -
VVGDYNFIC CHLE_HUMAN 420 57 -
VVGDHNVVC ACES_HUMAN 432 57 -
VVGDYNFIC CHLE_RABIT 399 57 -
IVGDHNVIC ACES_TORCA 415 57 -
IVGDHNVIC ACES_TORMA 418 57 -
IVGDHNVVC ACES_CHICK 587 57 -
IVGDHNVIC ACES_BUNFA 425 57 -
VIGDYNIIC CHLE_MOUSE 421 57 -
VVGDYFFVC ACES_LEPDE 450 58 -

Motif 5 width=8
Element Seqn Id St Int Rpt
WGEWMGVI ACES_LEPDE 488 29 -
WPLWMGVP ACES_BOVIN 439 29 -
WPLWMGVP ACES_RAT 470 29 -
WPLWMGVP ACES_MOUSE 470 29 -
WPEWMGVM CHLE_HUMAN 458 29 -
WPLWMGVP ACES_HUMAN 470 29 -
WPEWMGVM CHLE_RABIT 437 29 -
WPEWMGVI ACES_TORCA 453 29 -
WPEWMGVI ACES_TORMA 456 29 -
WPSWMGVP ACES_CHICK 625 29 -
WPPWMGVP ACES_BUNFA 463 29 -
WPEWMGVM CHLE_MOUSE 459 29 -
WGEWMGVL ACES_ANOST 496 29 -
WGEWMGVL ACES_DROME 510 29 -
WPEWMGVL ACE1_CAEBR 460 29 -
WPEWMGVL ACE1_CAEEL 460 29 -
WPLWMGVP ACES_RABIT 440 29 -
WGEWMGVL S66236 493 29 -

Motif 6 width=13
Element Seqn Id St Int Rpt
HGYEIEFVFGLPL ACES_TORMA 464 0 -
HGYEINFIFGEPL ACE1_CAEEL 468 0 -
HGYEINFIFGEPF ACE1_CAEBR 468 0 -
HGDEIEYFFGQPL ACES_DROME 518 0 -
HGYEIEFVFGLPL ACES_CHICK 633 0 -
HGYEIEFIFGLPL ACES_BOVIN 447 0 -
HGYEIEFIFGLPL ACES_RABIT 448 0 -
HGDEVEYIFGQPM S66236 501 0 -
HGYEIEFVFGLPL ACES_BUNFA 471 0 -
HGYEIEFVFGLPL CHLE_MOUSE 467 0 -
HGDEVEYVFGHPL ACES_LEPDE 496 0 -
HGYEIEFIFGLPL ACES_RAT 478 0 -
HGYEIEFIFGLPL ACES_MOUSE 478 0 -
HGYEIEFVFGLPL CHLE_HUMAN 466 0 -
HGYEIEFIFGIPL ACES_HUMAN 478 0 -
HGDEVEYIFGQPM ACES_ANOST 504 0 -
HGYEIEFVFGLPL CHLE_RABIT 445 0 -
HGYEIEFVFGLPL ACES_TORCA 461 0 -
Final Motifs
Motif 1  width=15
Element Seqn Id St Int Rpt
DTLYPGFEGTEMWNP O62762 102 102 -
DTLYPGFEGTEMWNP O62763 102 102 -
DTLYPGFEGTEMWNP ACES_BOVIN 74 74 -
DTLYPGFEGTEMWNP ACES_RAT 105 105 -
DTLYPGFEGTEMWNP ACES_MOUSE 105 105 -
DTSYPGFSGTEMWNP O42275 96 96 -
DQSFPGFHGSEMWNP CHLE_HUMAN 98 98 -
DTLYPGFEGTEMWNP ACES_HUMAN 105 105 -
DQSFPGFHGSEMWNP CHLE_RABIT 77 77 -
DEQFPGFSGSEMWNP ACES_TORCA 93 93 -
DEQFPGFPGSEMWNP ACES_TORMA 96 96 -
DTTFPGFQGSEMWNP ACES_CHICK 99 99 -
DQSFPGFPGSEMWNP O62760 98 98 -
DQSFPGFPGSEMWNP O62761 98 98 -
DTSYPGFQGTEMWNP ACES_BUNFA 103 103 -
DQAFPGFQGSEMWNP CHLE_MOUSE 99 99 -
DTTFPGYKGAEMWNP O76999 97 97 -
DEAFPGFHGAEMWNP O76998 90 90 -
YEYFPGFEGEEMWNP ACES_LEPDE 108 108 -
YEYFPGFAGEEMWNP ACES_ANOST 100 100 -
YEYFPGFSGEEIWNP ACES_DROME 109 109 -
YEYFPGFSGEEIWNP P91954 168 168 -
DTYFGDFYGSTMWNP ACE1_CAEBR 87 87 -
DTLYGNFSGSTMWNA O45210 125 125 -
DTYFGDFYGSTMWNA ACE1_CAEEL 87 87 -
DTLYGNFSGSTMWNA O61987 120 120 -

Motif 2 width=30
Element Seqn Id St Int Rpt
YGGGFYSGASSLDVYDGRFLAQAEGTVLVS O62762 147 30 -
YGGGFYSGASSLDVYDGRFLAQAEGTVLVS O62763 147 30 -
YGGGFYSGASSLDVYDGRFLVQAEGTVLVS ACES_BOVIN 119 30 -
YGGGFYSGASSLDVYDGRFLAQVEGTVLVS ACES_RAT 150 30 -
YGGGFYSGAASLDVYDGRFLAQVEGAVLVS ACES_MOUSE 150 30 -
YGGGFYSGSSSLDVYDGRYLAHSEKVVVVS O42275 141 30 -
YGGGFQTGTSSLHVYDGKFLARVERVIVVS CHLE_HUMAN 142 29 -
YGGGFYSGASSLDVYDGRFLVQAERTVLVS ACES_HUMAN 150 30 -
YGGGFQTGTSSLQVYDGKFLTRVERVIVVS CHLE_RABIT 121 29 -
YGGGFYSGSSTLDVYNGKYLAYTEEVVLVS ACES_TORCA 137 29 -
YGGGFYSGSSTLDVYNGKYLAYTEEVVLVS ACES_TORMA 140 29 -
YGGGFTGGSVSLDVYDGRYLAAAEEAVVVS ACES_CHICK 143 29 -
YGGGFQTGTSSLPVYDGKFLARVERVIVVS O62760 142 29 -
YGGGFQTGTSSLPVYDGKFLARVERVIVVS O62761 142 29 -
YGGGFYSGAASLDVYDGRFLTYTQNVILVS ACES_BUNFA 147 29 -
YGGGFQTGTSSLPVYDGKFLARVERVIVVS CHLE_MOUSE 143 29 -
YGGGFMSGTSSLDVYDGRYLARTQGVIVAS O76999 141 29 -
YGGGFFSGTSSLDVYDGRYLARMEDVVVVS O76998 134 29 -
YGGGYMSGTATLDVYDADIIAATSDVIVAS ACES_LEPDE 164 41 -
YGGGFMSGTSTLDIYNAEILAAVGNVIVAS ACES_ANOST 172 57 -
YGGGFMTGSATLDIYNADIMAAVGNVIVAS ACES_DROME 186 62 -
YGGGFMTGSATLDIYNADIMSAVGNVIVAS P91954 243 60 -
YGGGFWSGTSTLDVYDGRILTVEENVILVA ACE1_CAEBR 133 31 -
YGGGFYSGTSTLDVYDARTLVSEENVVVVS O45210 173 33 -
YGGGFWSGTATLDVYDGRILTVEENVILVA ACE1_CAEEL 133 31 -
YGGGFYSGTSTLDVYDARTLVSEENVVVVA O61987 168 33 -

Motif 3 width=9
Element Seqn Id St Int Rpt
GSYFLVYGA O62762 363 186 -
GSYFLVYGA O62763 363 186 -
GSYFLVYGA ACES_BOVIN 335 186 -
GSYFLVYGV ACES_RAT 366 186 -
GSYFLVYGV ACES_MOUSE 366 186 -
GSYFLIYGA O42275 353 182 -
GTAFLVYGA CHLE_HUMAN 354 182 -
GSYFLVYGA ACES_HUMAN 366 186 -
GTAFLVYGA CHLE_RABIT 333 182 -
GSFFLLYGA ACES_TORCA 349 182 -
GSFFLLYGA ACES_TORMA 352 182 -
GSYFLVYGV ACES_CHICK 521 348 -
GTAFLVYGA O62760 354 182 -
GTAFLVYGA O62761 354 182 -
GSYFLIYGL ACES_BUNFA 359 182 -
GTAFLVYGA CHLE_MOUSE 355 182 -
GVYFLLYGA O76999 350 179 -
GNFWLVYGV O76998 350 186 -
GTYFLLYDF ACES_LEPDE 383 189 -
GTYFLLYDF ACES_ANOST 391 189 -
GTYFLLYDF ACES_DROME 406 190 -
GTYFLLYDF P91954 462 189 -
SIYFLTYQL ACE1_CAEBR 347 184 -
GSWFLQYFF O45210 382 179 -
SIYFLTYQL ACE1_CAEEL 347 184 -
GSWFLQYFF O61987 377 179 -

Motif 4 width=9
Element Seqn Id St Int Rpt
VVGDHNVVC O62762 429 57 -
VVGDHNVVC O62763 429 57 -
VVGDHNVVC ACES_BOVIN 401 57 -
VVGDHNVVC ACES_RAT 432 57 -
VVGDHNVVC ACES_MOUSE 432 57 -
IVGDHNVVC O42275 419 57 -
VVGDYNFIC CHLE_HUMAN 420 57 -
VVGDHNVVC ACES_HUMAN 432 57 -
VVGDYNFIC CHLE_RABIT 399 57 -
IVGDHNVIC ACES_TORCA 415 57 -
IVGDHNVIC ACES_TORMA 418 57 -
IVGDHNVVC ACES_CHICK 587 57 -
VLGDYNIIC O62760 420 57 -
VLGDYNIIC O62761 420 57 -
IVGDHNVIC ACES_BUNFA 425 57 -
VIGDYNIIC CHLE_MOUSE 421 57 -
LSGDYNFIC O76999 416 57 -
VFGDYFFVC O76998 416 57 -
VVGDYFFVC ACES_LEPDE 450 58 -
AVGDHFFIC ACES_ANOST 458 58 -
AVGDHFFTC ACES_DROME 472 57 -
AVGDHFFTC P91954 528 57 -
MLGDYHFTC ACE1_CAEBR 422 66 -
IVGDYHFTC O45210 448 57 -
MLGDYHFTC ACE1_CAEEL 422 66 -
IVGDYHFTC O61987 443 57 -

Motif 5 width=8
Element Seqn Id St Int Rpt
WPLWMGVP O62762 467 29 -
WPLWMGVP O62763 467 29 -
WPLWMGVP ACES_BOVIN 439 29 -
WPLWMGVP ACES_RAT 470 29 -
WPLWMGVP ACES_MOUSE 470 29 -
WPEWMGVI O42275 486 58 -
WPEWMGVM CHLE_HUMAN 458 29 -
WPLWMGVP ACES_HUMAN 470 29 -
WPEWMGVM CHLE_RABIT 437 29 -
WPEWMGVI ACES_TORCA 453 29 -
WPEWMGVI ACES_TORMA 456 29 -
WPSWMGVP ACES_CHICK 625 29 -
WPEWMGVM O62760 458 29 -
WPEWMGVM O62761 458 29 -
WPPWMGVP ACES_BUNFA 463 29 -
WPEWMGVM CHLE_MOUSE 459 29 -
WPKWTGVM O76999 454 29 -
WPHWMGAM O76998 454 29 -
WGEWMGVI ACES_LEPDE 488 29 -
WGEWMGVL ACES_ANOST 496 29 -
WGEWMGVL ACES_DROME 510 29 -
WGEWMGVL P91954 566 29 -
WPEWMGVL ACE1_CAEBR 460 29 -
WPQWTGVI O45210 486 29 -
WPEWMGVL ACE1_CAEEL 460 29 -
WPQWTGVM O61987 481 29 -

Motif 6 width=13
Element Seqn Id St Int Rpt
HGYEIEFIFGLPL O62762 475 0 -
HGYEIEFIFGLPL O62763 475 0 -
HGYEIEFIFGLPL ACES_BOVIN 447 0 -
HGYEIEFIFGLPL ACES_RAT 478 0 -
HGYEIEFIFGLPL ACES_MOUSE 478 0 -
HGYEIEFVFGLPL O42275 494 0 -
HGYEIEFVFGLPL CHLE_HUMAN 466 0 -
HGYEIEFIFGIPL ACES_HUMAN 478 0 -
HGYEIEFVFGLPL CHLE_RABIT 445 0 -
HGYEIEFVFGLPL ACES_TORCA 461 0 -
HGYEIEFVFGLPL ACES_TORMA 464 0 -
HGYEIEFVFGLPL ACES_CHICK 633 0 -
HGYEIEFVFGLPL O62760 466 0 -
HGYEIEFVFGLPL O62761 466 0 -
HGYEIEFVFGLPL ACES_BUNFA 471 0 -
HGYEIEFVFGLPL CHLE_MOUSE 467 0 -
HGYECEFVFGLPT O76999 462 0 -
HGYEIEFIFGLPI O76998 462 0 -
HGDEVEYVFGHPL ACES_LEPDE 496 0 -
HGDEVEYIFGQPM ACES_ANOST 504 0 -
HGDEIEYFFGQPL ACES_DROME 518 0 -
HGDEIEYFFGQPL P91954 574 0 -
HGYEINFIFGEPF ACE1_CAEBR 468 0 -
HGEEVPFVFGEPL O45210 494 0 -
HGYEINFIFGEPL ACE1_CAEEL 468 0 -
HGEEVPFVFGEPL O61987 489 0 -