SPRINT Home UMBER Home Contents Standard Search Advanced Search Relation Search

==SPRINT==> PRINTS View



  selected as


PR00600

Identifier
PP2APR55  [View Relations]  [View Alignment]  
Accession
PR00600
No. of Motifs
11
Creation Date
21-MAR-1996  (UPDATE 07-JUN-1999)
Title
Protein phosphatase PP2A 55kD regulatory subunit signature
Database References

PROSITE; PS01024 PR55_1; PS01025 PR55_2
BLOCKS; BL01024
PFAM; PF01240 PR55
INTERPRO; IPR000009
Literature References
1. MAYER, R.E., HENDRIX, P., CRON, P., MATTIES, R., STONE, S.R., GORIS, J.,
MERLEVEDE, W., HOFSTEENGE, J. AND HEMMINGS, B.A.
Structure of the 55kDa regulatory subunit of protein phosphatase 2A:
evidence for a neuronal-specific isoform.
BIOCHEMISTRY 30 3589-3597 (1991).
 
2. PALLAS, D.C., WELLER, W., JASPERS, S., MILLER, T.B., LANE, W.S. AND 
ROBERTS, T.M.
The third subunit of protein phosphatase 2A (PP2A), a 55-kilodalton protein 
which is apparently substituted for by T antigens in complexes with the
36- and 63-kilodalton PP2A subunits, bears little resemblence to T antigens.
J.VIROL. 66 886-893 (1992).

Documentation
Protein phosphatase 2A (PP2A) is a serine/threonine phosphatase implicated 
in many cellular processes, including the regulation of metabolic enzymes 
and proteins involved in signal transduction [1,2]. PP2A is a trimer
composed of a 36kDa catalytic subunit, a 65kDa regulatory subunit 
(subunit A) and a variable third subunit (subunit B) [1,2]. 
 
One form of the third subunit is a 55kDa protein (PR55), which exists in
Drosophila and yeast, and has up to 3 forms in mammals [1,2]. PR55 may act
as a substrate recognition unit, or may help to target the enzyme to the
correct subcellular location [1]. The small and middle T-antigens of polyoma
virus have also been shown to associate with the catalytic and 65kDa PP2A
subunits, apparently substituting for PR55. Surprisingly, little sequence
similarity can be identified between the 2 proteins [2].
 
PP2APR55 is an 11-element fingerprint that provides a signature for the
PP2A PR55 regulatory subunit. The fingerprint was derived from an initial
alignment of 7 sequences: the motifs were drawn from virtually the full
alignment length, motifs 2 and 4 containing the regions encoded by PROSITE 
patterns PR55_1 (PS01024) and PR55_2 (PS01025). Two iterations on OWL27.0
were required to reach convergence, at which point a true set comprising 15
sequences was identified. Three partial matches were also found, all PR55 
subunit fragments. 
 
An update on SPTR37_9f identified a true set of 16 sequences.
Summary Information
16 codes involving 11 elements
0 codes involving 10 elements
0 codes involving 9 elements
0 codes involving 8 elements
0 codes involving 7 elements
0 codes involving 6 elements
0 codes involving 5 elements
0 codes involving 4 elements
0 codes involving 3 elements
0 codes involving 2 elements
Composite Feature Index
111616161616161616161616
1000000000000
900000000000
800000000000
700000000000
600000000000
500000000000
400000000000
300000000000
200000000000
1234567891011
True Positives
2ABA_CANTR    2ABA_DROME    2ABA_HUMAN    2ABA_RAT      
2ABA_YEAST 2ABB_HUMAN 2ABB_PIG 2ABB_RAT
2ABG_RABIT O82774 P87345 P90851
P97888 Q12702 Q38821 Q39247
Sequence Titles
2ABA_CANTR  PROTEIN PHOSPHATASE PP2A REGULATORY SUBUNIT B (PR55) (CELL DIVISION CONTROL PROTEIN 55) - CANDIDA TROPICALIS (YEAST). 
2ABA_DROME PROTEIN PHOSPHATASE PP2A, 55 KD REGULATORY SUBUNIT (PROTEIN PHOSPHATASE PP2A REGULATORY SUBUNIT B) (PR55) (TWINS PROTEIN) - DROSOPHILA MELANOGASTER (FRUIT FLY).
2ABA_HUMAN PROTEIN PHOSPHATASE PP2A, 55 KD REGULATORY SUBUNIT, ALPHA ISOFORM (PROTEIN PHOSPHATASE PP2A B SUBUNIT ALPHA ISOFORM) (ALPHA-PR55) - HOMO SAPIENS (HUMAN), AND ORYCTOLAGUS CUNICULUS (RABBIT).
2ABA_RAT PROTEIN PHOSPHATASE PP2A, 55 KD REGULATORY SUBUNIT, ALPHA ISOFORM (PROTEIN PHOSPHATASE PP2A B SUBUNIT ALPHA ISOFORM) (ALPHA-PR55) (PP2A BRA) - RATTUS NORVEGICUS (RAT).
2ABA_YEAST PROTEIN PHOSPHATASE PP2A REGULATORY SUBUNIT B (PR55) (CELL DIVISION CONTROL PROTEIN 55) - SACCHAROMYCES CEREVISIAE (BAKER'S YEAST).
2ABB_HUMAN PROTEIN PHOSPHATASE PP2A, 55 KD REGULATORY SUBUNIT, NEURONAL ISOFORM (PROTEIN PHOSPHATASE PP2A B SUBUNIT BETA ISOFORM) (BETA-PR55) - HOMO SAPIENS (HUMAN).
2ABB_PIG PROTEIN PHOSPHATASE PP2A, 55 KD REGULATORY SUBUNIT, NEURONAL ISOFORM (PROTEIN PHOSPHATASE PP2A B SUBUNIT BETA ISOFORM) (BETA-PR55) - SUS SCROFA (PIG).
2ABB_RAT PROTEIN PHOSPHATASE PP2A, 55 KD REGULATORY SUBUNIT, BETA ISOFORM (PROTEIN PHOSPHATASE PP2A B SUBUNIT BETA ISOFORM) (BETA-PR55) (PP2A BRB) - RATTUS NORVEGICUS (RAT).
2ABG_RABIT PROTEIN PHOSPHATASE PP2A, 55 KD REGULATORY SUBUNIT, GAMMA ISOFORM (PROTEIN PHOSPHATASE PP2A B SUBUNIT GAMMA ISOFORM) (GAMMA-PR55) - ORYCTOLAGUS CUNICULUS (RABBIT).
O82774 PROTEIN PHOSPHATASE 2A 55 KDA B REGULATORY SUBUNIT - ORYZA SATIVA (RICE).
P87345 PROTEIN PHOSPHATASE 2A REGULATORY SUBUNIT - XENOPUS LAEVIS (AFRICAN CLAWED FROG).
P90851 F26E4.1 PROTEIN - CAENORHABDITIS ELEGANS.
P97888 PROTEIN PHOSPHATASE PP2A, 55 KD REGULATORY SUBUNIT, GAMMA ISOFORM (PROTEIN PHOSPHATASE PP2A B SUBUNIT GAMMA ISOFORM) (GAMMA-PR55) (BRGAMMA) - RATTUS NORVEGICUS (RAT).
Q12702 PROTEIN PHOSPHATASE PP2A REGULATORY SUBUNIT B (PR55) (PROTEIN PHOSPHATASE 2A 55 KD REGULATORY SUBUNIT) - SCHIZOSACCHAROMYCES POMBE (FISSION YEAST).
Q38821 55 KDA B REGULATORY SUBUNIT OF PHOSPHATASE 2A - ARABIDOPSIS THALIANA (MOUSE-EAR CRESS).
Q39247 TYPE 2A PROTEIN SERINE/THREONINE PHOSPHATASE 55 KDA B REGULATORY SUBUNIT - ARABIDOPSIS THALIANA (MOUSE-EAR CRESS).
Scan History
OWL27_0    2  100  NSINGLE    
SPTR37_9f 2 17 NSINGLE
Initial Motifs
Motif 1  width=21
Element Seqn Id St Int Rpt
EFNHSGELLATGDKGGRVVIF P97888 35 35 -
EFNHDGELLATGDKGGRVVIF 2ABA_DROME 88 88 -
EFNHTGELLATGDKGGRVVIF 2ABB_RABIT 1 1 -
EFDYTGNYLATGDKGGRVVLF 2ABA_YEAST 32 32 -
EFNHTGELLATGDKGGRVVIF 2ABB_HUMAN 31 31 -
EFNHSGELLATGDKGGRVVIF 2ABA_RAT 35 35 -
EFNHSGELLATGDKGGRVVIF 2ABA_HUMAN 35 35 -

Motif 2 width=29
Element Seqn Id St Int Rpt
EYNVYSTFQSHEPEFDYLKSLEIEEKINK 2ABA_HUMAN 70 14 -
EYNVYSTFQSHEPEFDYLKSLEIEEKINK 2ABA_RAT 70 14 -
EYKFLTEFQSHDAEFDYLKSLEIEEKINE 2ABA_YEAST 61 8 -
EYNVYSTFQSHEPEFDYLKSLEIEEKINK 2ABA_DROME 123 14 -
EYNVYSTFQSHEPEFDYLKSLEIEEKINK 2ABB_RABIT 36 14 -
EYNVYSTFQSHEPEFDYLKSLEIEEKINK 2ABB_HUMAN 66 14 -
EYNVYSTFQSHEPEFDYLKSLEIEEKINK P97888 87 31 -

Motif 3 width=29
Element Seqn Id St Int Rpt
IRWLQQKNPVHFLLSTNDKTVKLWKVSER 2ABA_DROME 152 0 -
IRWLPQQNAAYFLLSTNDKTVKLWKVSER 2ABB_RABIT 65 0 -
IRWLPQQNAAYFLLSTNDKTVKLWKVSER 2ABB_HUMAN 95 0 -
IRWLPQKNAAQFLLSTNDKTIKLWKISER 2ABA_RAT 99 0 -
IRWLPQKNAAQFLLSTNDKTIKLWKISER 2ABA_HUMAN 99 0 -
IRWLPQENAAQFLLSTNDKTIKLWKISER P97888 116 0 -
IKWLRPTQRSHFLLSTNDKTIKLWKVYEK 2ABA_YEAST 90 0 -

Motif 4 width=28
Element Seqn Id St Int Rpt
HTYHINSISVNSDYETYMSADDLRINLW 2ABB_RABIT 142 48 -
HTYHINSISVNSDYETYMSADDLRINLW 2ABB_HUMAN 172 48 -
HTYHINSISINSDYETYLSADDLRINLW 2ABA_RAT 176 48 -
HTYHINSISINSDYETYLSADDLRINLW 2ABA_HUMAN 176 48 -
HTYHINSISINSDYETYLSADDLRINLW P97888 193 48 -
HTYHINSISVNSDQETFLSADDLRINLW 2ABA_DROME 229 48 -
HTYHINSISLNSDQETFLSADDLRINLW 2ABA_YEAST 183 64 -

Motif 5 width=28
Element Seqn Id St Int Rpt
HLEITDRSFNIVDIKPANMEELTEVITA P97888 221 0 -
NFEITNQSFNIVDIKPANMEELTEVITA 2ABB_RABIT 170 0 -
NFEITNQSFNIVDIKPANMEELTEVITA 2ABB_HUMAN 200 0 -
HLEITDRSFNIVDIKPANMEELTEVITA 2ABA_RAT 204 0 -
HLEITDRSFNIVDIKPANMEELTEVITA 2ABA_HUMAN 204 0 -
HLEVVNQSYNIVDIKPTNMEELTEVITA 2ABA_DROME 257 0 -
NLDIPDQSFNIVDIKPTNMEELTEVITS 2ABA_YEAST 211 0 -

Motif 6 width=29
Element Seqn Id St Int Rpt
AEFHPNSCNTFVYSSSKGTIRLCDMRASA 2ABA_RAT 232 0 -
AEFHPNSCNTFVYSSSKGTIRLCDMRASA 2ABA_HUMAN 232 0 -
AEFHPNSCNTFVYSSSKGTIRLCDMRASA P97888 249 0 -
AEFHPTECNVFVYSSSKGTIRLCDMRSAA 2ABA_DROME 285 0 -
AEFHPQECNLFMYSSSKGTIKLCDMRQNS 2ABA_YEAST 239 0 -
AEFHPHHCNTFVYSSSKGTIRLCDMRASA 2ABB_RABIT 198 0 -
AEFHPHHCNTFVYSSSKGTIRLCDMRASA 2ABB_HUMAN 228 0 -

Motif 7 width=28
Element Seqn Id St Int Rpt
LCDRHSKLFEEPEDPSNRSFFSEIISSI 2ABA_RAT 261 0 -
LCDRHSKLFEEPEDPSNRSFFSEIISSI P97888 278 0 -
LCDRHSKQFEEPENPTNRSFFSEIISSI 2ABA_DROME 314 0 -
LCDNKTKTFEEYLDPINHNFFTEITSSI 2ABA_YEAST 268 0 -
LCDRHTKFFEEPEDPSNRSFFSEIISSI 2ABB_RABIT 227 0 -
LCDRHTKFFEEPEDPSNRSFFSEIISSI 2ABB_HUMAN 257 0 -
LCDRHSKLFEEPEDPSNRSFFSEIISSI 2ABA_HUMAN 261 0 -

Motif 8 width=28
Element Seqn Id St Int Rpt
SDVKFSHSGRYMMTRDYLSVKIWDLNME 2ABA_HUMAN 289 0 -
SDVKLSNSGRYMISRDYLSIKVWDLHME 2ABA_DROME 342 0 -
SDIKFSPNGRYIASRDYLTVKIWDVNMD 2ABA_YEAST 296 0 -
SDVKFSHSGRYIMTRDYLTVKVWDLNME 2ABB_RABIT 255 0 -
SDVKFSHSGRYIMTRDYLTVKVWDLNME 2ABB_HUMAN 285 0 -
SDVKFSHSGRYMMTRDYLSVKVWDLNME 2ABA_RAT 289 0 -
SDVKFSHSGRYMMTRDYLSVKVWDLNME P97888 306 0 -

Motif 9 width=26
Element Seqn Id St Int Rpt
NRPVETYQVHEYLRSKLCSLYENDCI P97888 334 0 -
NRPIETYQVHDYLRSKLCSLYENDCI 2ABB_RABIT 283 0 -
NKPLKTINIHEQLKERLSDTYENDAI 2ABA_YEAST 324 0 -
NRPIETYQVHDYLRSKLCSLYENDCI 2ABB_HUMAN 313 0 -
NRPVETYQVHEYLRSKLCSLYENDCI 2ABA_RAT 317 0 -
NRPVETYQVHEYLRSKLCSLYENDCI 2ABA_HUMAN 317 0 -
TKPIETYPVHEYLRAKLCSLYENDCI 2ABA_DROME 370 0 -

Motif 10 width=27
Element Seqn Id St Int Rpt
FDKFECCWNGSDSVVMTGSYNNFFRMF 2ABA_RAT 343 0 -
FDKFECVWNGSDSVIMTGSYNNFFRMF 2ABB_HUMAN 339 0 -
FDKFECCWNGSDSVVMTGSYNNFFRMF 2ABA_HUMAN 343 0 -
FDKFECCWNGSDSVVMTGSYNNFFRMF P97888 360 0 -
FDKFECCWNGKDSSIMTGSYNNFFRVF 2ABA_DROME 396 0 -
FDKFEVNFSGDSSSVMTGSYNNNFMIY 2ABA_YEAST 350 0 -
FDKFECVWNGSDSVIMTGSYNNFFRMF 2ABB_RABIT 309 0 -

Motif 11 width=30
Element Seqn Id St Int Rpt
LDFNKKILHTAWHPKENIIAVATTNNLYIF P97888 430 43 -
IDFKKNNLHFSWHPRENSIAVAATNNLFIF 2ABA_YEAST 494 117 -
LDFSKKILHTAWHPSENIIAVAATNNLYIF 2ABB_HUMAN 409 43 -
LDFNKKILHTAWHPKENIIAVATTNNLYIF 2ABA_RAT 413 43 -
LDFSKKILHTAWHPSENIIAVAATNNLYIF 2ABB_RABIT 379 43 -
LDFNKKILHTAWHPKENIIAVATTNNLYIF 2ABA_HUMAN 413 43 -
LDFNKKILHTAWHPEENIIAVAATNNLFIF 2ABA_DROME 466 43 -
Final Motifs
Motif 1  width=21
Element Seqn Id St Int Rpt
EFNHTGELLATGDKGGRVVIF 2ABB_HUMAN 31 31 -
EFNHTGELLATGDKGGRVVIF 2ABB_RAT 31 31 -
EFNNTGELLATGDKGGRVVIF P87345 56 56 -
EFNHSGELLATGDKGGRVVIF 2ABA_RAT 35 35 -
EFNHSGELLATGDKGGRVVIF 2ABA_HUMAN 35 35 -
EFNHTGELLATGDKGGRVVIF 2ABG_RABIT 31 31 -
EFNHSGELLATGDKGGRVVIF P97888 35 35 -
EFNHDGELLATGDKGGRVVIF 2ABA_DROME 88 88 -
EFNHTGELLATGDKGGRVVIF 2ABB_PIG 31 31 -
EFSHDGEYLATGDKGGRVVIF P90851 73 73 -
EFDKSGDHLATGDRGGRVVLF O82774 59 59 -
EFDKSGDHLATGDRGGRVVLF Q39247 43 43 -
EFDHTGDFLATGDKGGRVVLF 2ABA_CANTR 28 28 -
EFDHTGDYLATGDKGGRVVLF Q12702 36 36 -
EFDNSGNHLATGDRGGRVVLF Q38821 45 45 -
EFDYTGNYLATGDKGGRVVLF 2ABA_YEAST 32 32 -

Motif 2 width=29
Element Seqn Id St Int Rpt
EYNVYSTFQSHEPEFDYLKSLEIEEKINK 2ABB_HUMAN 66 14 -
EYNVYSTFQSHEPEFDYLKSLEIEEKINK 2ABB_RAT 66 14 -
EYNVYSTFQSHEPEFDYLKSLEIEEKINK P87345 91 14 -
EYNVYSTFQSHEPEFDYLKSLEIEEKINK 2ABA_RAT 70 14 -
EYNVYSTFQSHEPEFDYLKSLEIEEKINK 2ABA_HUMAN 70 14 -
EYDVYSTFQSHEPEFDYLKSLEIEEKINK 2ABG_RABIT 66 14 -
EYNVYSTFQSHEPEFDYLKSLEIEEKINK P97888 87 31 -
EYNVYSTFQSHEPEFDYLKSLEIEEKINK 2ABA_DROME 123 14 -
EYNVYSTFQSHEPEFDYLKSLEIEEKINK 2ABB_PIG 66 14 -
EYNVYSTFQSHEPEFDYLKSLEIDEKINQ P90851 109 15 -
EFRYKTEFQSHEPEFDYLKSLEIEEKINK O82774 105 25 -
EFRYKTEFQSHEPEFDYLKSLEIEEKINK Q39247 89 25 -
EYKFFTEFQSHDAEFDYLKSLEIEEKINK 2ABA_CANTR 60 11 -
EYKFFTEFQSHEPEFDYLKSLEIEEKINK Q12702 66 9 -
EFRYKTEFQSHDPEFDYLKSLEIEEKINK Q38821 91 25 -
EYKFLTEFQSHDAEFDYLKSLEIEEKINE 2ABA_YEAST 61 8 -

Motif 3 width=29
Element Seqn Id St Int Rpt
IRWLPQQNAAYFLLSTNDKTVKLWKVSER 2ABB_HUMAN 95 0 -
IRWLPQQNAAYFLLSTNDKTVKLWKVSER 2ABB_RAT 95 0 -
IRWLPQQNAAYFLLSTNDKTVKLWKVSER P87345 120 0 -
IRWLPQKNAAQFLLSTNDKTIKLWKISER 2ABA_RAT 99 0 -
IRWLPQKNAAQFLLSTNDKTIKLWKISER 2ABA_HUMAN 99 0 -
IKWLPQQNAAHSLLSTNDKTIKLWKITER 2ABG_RABIT 95 0 -
IRWLPQENAAQFLLSTNDKTIKLWKISER P97888 116 0 -
IRWLQQKNPVHFLLSTNDKTVKLWKVSER 2ABA_DROME 152 0 -
IRWLPQQNAAYFLLSTNDKTVKLWKVSER 2ABB_PIG 95 0 -
IRWLKKKNAANFILSTNDKTIKLWKISER P90851 138 0 -
IKWCQTANNALFLLSTNDKTIKYWKVQER O82774 134 0 -
IRWCQPANGALFLLSTNDKTIKYWKVQEK Q39247 118 0 -
IKWLKSANDSLCLLSTNDKTIKLWKIQER 2ABA_CANTR 89 0 -
IRWCKRTNRAHFLLSTNDKTIKLWKLYEK Q12702 95 0 -
IRWCQTANGALFLLSTNDKTIKFWKVQDK Q38821 120 0 -
IKWLRPTQRSHFLLSTNDKTIKLWKVYEK 2ABA_YEAST 90 0 -

Motif 4 width=28
Element Seqn Id St Int Rpt
HTYHINSISVNSDYETYMSADDLRINLW 2ABB_HUMAN 172 48 -
HTYHINSISVNSDYETYMSADDLRINLW 2ABB_RAT 172 48 -
HTYHINSISVNSDYETYMSADDLRINLW P87345 197 48 -
HTYHINSISINSDYETYLSADDLRINLW 2ABA_RAT 176 48 -
HTYHINSISINSDYETYLSADDLRINLW 2ABA_HUMAN 176 48 -
HTYHINSISVNSDCETYMSADDLRINLW 2ABG_RABIT 172 48 -
HTYHINSISINSDYETYLSADDLRINLW P97888 193 48 -
HTYHINSISVNSDQETFLSADDLRINLW 2ABA_DROME 229 48 -
HTYHINSISVNSDYETYMSADDLRINLW 2ABB_PIG 172 48 -
HTYHVNSISVNSDQETFLSADDLRVNLW P90851 216 49 -
HDYHINSISNNSDGETYISADDLRINLW O82774 247 84 -
HDYHINSISNSSDGETFISADDLRVNLW Q39247 221 74 -
HAYHINSISVNSDQETYLSADDLRINLW 2ABA_CANTR 167 49 -
HAYHINSISVNSDAETYISADDLRINLW Q12702 175 51 -
HDYHINSISNNSDGETFISADDLRINLW Q38821 233 84 -
HTYHINSISLNSDQETFLSADDLRINLW 2ABA_YEAST 183 64 -

Motif 5 width=28
Element Seqn Id St Int Rpt
NFEITNQSFNIVDIKPANMEELTEVITA 2ABB_HUMAN 200 0 -
NFEITNQSFNIVDIKPANMEELTEVITA 2ABB_RAT 200 0 -
NLEITNRSFNIVDIKPTNMEELTEVITA P87345 225 0 -
HLEITDRSFNIVDIKPANMEELTEVITA 2ABA_RAT 204 0 -
HLEITDRSFNIVDIKPANMEELTEVITA 2ABA_HUMAN 204 0 -
HLAVTDRSFNIVDIKPANMEDLTEVITA 2ABG_RABIT 200 0 -
HLEITDRSFNIVDIKPANMEELTEVITA P97888 221 0 -
HLEVVNQSYNIVDIKPTNMEELTEVITA 2ABA_DROME 257 0 -
NFEITNQSFNIADIKPANMEELTEVITA 2ABB_PIG 200 0 -
NLEITNESFNIVDIKPANMEELTEVITA P90851 244 0 -
NLEISNQSFNIVDVKPANMEDLTEVITC O82774 275 0 -
NLEISNQSFNIVDVKPTNMEDLTEVITS Q39247 249 0 -
NLGIADQSFNIVDIKPANMEELTEVITS 2ABA_CANTR 195 0 -
NLSISDHSFNIVDIKPENMEELTEVITS Q12702 203 0 -
NLEISNQSFNIVDVKPAKMEDLSEVITS Q38821 261 0 -
NLDIPDQSFNIVDIKPTNMEELTEVITS 2ABA_YEAST 211 0 -

Motif 6 width=29
Element Seqn Id St Int Rpt
AEFHPHHCNTFVYSSSKGTIRLCDMRASA 2ABB_HUMAN 228 0 -
AEFHPHHCNTFVYSSSKGTIRLCDMRASA 2ABB_RAT 228 0 -
AEFHPHNCNTFVYSSSKGTIRLCDMRSSA P87345 253 0 -
AEFHPNSCNTFVYSSSKGTIRLCDMRASA 2ABA_RAT 232 0 -
AEFHPNSCNTFVYSSSKGTIRLCDMRASA 2ABA_HUMAN 232 0 -
SEFHPHHCNLFVYSSSKGSLRLCDMRAAA 2ABG_RABIT 228 0 -
AEFHPNSCNTFVYSSSKGTIRLCDMRASA P97888 249 0 -
AEFHPTECNVFVYSSSKGTIRLCDMRSAA 2ABA_DROME 285 0 -
AEFHPHHCNTFVYSSSKGTIRLCDMRASA 2ABB_PIG 228 0 -
AEFHPTQCNWFVYSSSKGSIRLCDMRDRA P90851 272 0 -
AEFHPTHCNTLAYSSSKGSIRLIDLRQSA O82774 303 0 -
AEFHPIHCNMLAYSSSKGSIRLIDMRQSA Q39247 277 0 -
AEFHPLQCNLFMYSSSKGTIKLSDMRSNS 2ABA_CANTR 223 0 -
AEFHPINCNHLMYSSSKGNIKLLDLRQSA Q12702 231 0 -
AEFHPTHCNMLAYSSSKGSIRLIDLRQSA Q38821 289 0 -
AEFHPQECNLFMYSSSKGTIKLCDMRQNS 2ABA_YEAST 239 0 -

Motif 7 width=28
Element Seqn Id St Int Rpt
LCDRHTKFFEEPEDPSNRSFFSEIISSI 2ABB_HUMAN 257 0 -
LCDRHTKFFEEPEDPSNRSFFSEIISSI 2ABB_RAT 257 0 -
LCDKHSKLFEEPEDPSNRSFFSEIISSI P87345 282 0 -
LCDRHSKLFEEPEDPSNRSFFSEIISSI 2ABA_RAT 261 0 -
LCDRHSKLFEEPEDPSNRSFFSEIISSI 2ABA_HUMAN 261 0 -
LCDKHSKLFEEPEDPSNRSFFSEIISSV 2ABG_RABIT 257 0 -
LCDRHSKLFEEPEDPSNRSFFSEIISSI P97888 278 0 -
LCDRHSKQFEEPENPTNRSFFSEIISSI 2ABA_DROME 314 0 -
CVTGTPNFLKEPEDPSNRSFSLKLSSSI 2ABB_PIG 257 0 -
LCDAYAKIFEEPEDPQSRSFFSEIIASV P90851 301 0 -
LCDNHAKLFEEHEAPGSRSFFTEIIASV O82774 332 0 -
LCDSHTKLFEEPEAPGSRSFFTEIIASI Q39247 306 0 -
LCDSHAKIFEEYLDPSSHNFFTEITSSI 2ABA_CANTR 252 0 -
LCDNPCKLFEDQEDQDSKSFFSEIISSI Q12702 260 0 -
LCDSHSKLFEEPEQAGPKSFFTEIIASV Q38821 318 0 -
LCDNKTKTFEEYLDPINHNFFTEITSSI 2ABA_YEAST 268 0 -

Motif 8 width=28
Element Seqn Id St Int Rpt
SDVKFSHSGRYIMTRDYLTVKVWDLNME 2ABB_HUMAN 285 0 -
SDVKFSHSGRYIMTRDYLTAKVWDLNME 2ABB_RAT 285 0 -
SDVKFNHSGRYIMTRDYLTVKVWDLNME P87345 310 0 -
SDVKFSHSGRYMMTRDYLSVKVWDLNME 2ABA_RAT 289 0 -
SDVKFSHSGRYMMTRDYLSVKIWDLNME 2ABA_HUMAN 289 0 -
SDVKFSHSGRYMLTRDYLTVKVWDLNME 2ABG_RABIT 285 0 -
SDVKFSHSGRYMMTRDYLSVKVWDLNME P97888 306 0 -
SDVKLSNSGRYMISRDYLSIKVWDLHME 2ABA_DROME 342 0 -
SDVKFSQQWEDIMTRDYLTVKVWDLNME 2ABB_PIG 285 0 -
SDVKFSHNGRYLLTRDYLTVKVWDLNME P90851 329 0 -
SDIKFARDGRHILSRDYMTLKLWDINMD O82774 360 0 -
SDIKFSKDGRYILSRDYMTLKLWDINMD Q39247 334 0 -
SDVKFSHDGRYIASRDYMTVKIWDLAME 2ABA_CANTR 280 0 -
SDVKFSQNGRYILSRDYLTLKIWDVNME Q12702 288 0 -
SDIKFAKEGRYLLSRDYMTLKLWDINMD Q38821 346 0 -
SDIKFSPNGRYIASRDYLTVKIWDVNMD 2ABA_YEAST 296 0 -

Motif 9 width=26
Element Seqn Id St Int Rpt
NRPIETYQVHDYLRSKLCSLYENDCI 2ABB_HUMAN 313 0 -
NRPVETYQVHDYLRSKLCSLYENDCI 2ABB_RAT 313 0 -
NRPIETYQVHDYLRSKLCSLYENDCI P87345 338 0 -
NRPVETYQVHEYLRSKLCSLYENDCI 2ABA_RAT 317 0 -
NRPVETYQVHEYLRSKLCSLYENDCI 2ABA_HUMAN 317 0 -
ARPIETYQVHDYLRSKLCSLYENDCI 2ABG_RABIT 313 0 -
NRPVETYQVHEYLRSKLCSLYENDCI P97888 334 0 -
TKPIETYPVHEYLRAKLCSLYENDCI 2ABA_DROME 370 0 -
NRPIETYQVHNYLRSKLCSLYENDCI 2ABB_PIG 313 0 -
SQPVETYPVHNYLRTKLCALYENDSI P90851 357 0 -
SGPVATFQVHEYLRPKLCDLYENDSI O82774 388 0 -
SGPVASYQVHEHLRPRLCDLYENDSI Q39247 362 0 -
NKPIKTIDVHEHLRERLCDTYENDAI 2ABA_CANTR 308 0 -
KAPVKTIPLHDVLRSKLCDLYENDCI Q12702 316 0 -
AGPVATFQVHEYLKPKLCDLYENDSI Q38821 374 0 -
NKPLKTINIHEQLKERLSDTYENDAI 2ABA_YEAST 324 0 -

Motif 10 width=27
Element Seqn Id St Int Rpt
FDKFECVWNGSDSVIMTGSYNNFFRMF 2ABB_HUMAN 339 0 -
FDKFECVWNGSDSVIMTGSYNNFFRMF 2ABB_RAT 339 0 -
FDKFECVWNGSDSVIMTGSYNNFFRMF P87345 364 0 -
FDKFECCWNGSDSVVMTGSYNNFFRMF 2ABA_RAT 343 0 -
FDKFECCWNGSDSVVMTGSYNNFFRMF 2ABA_HUMAN 343 0 -
FDKFECAWNGSDSVIMTGAYNNFFRMF 2ABG_RABIT 339 0 -
FDKFECCWNGSDSVVMTGSYNNFFRMF P97888 360 0 -
FDKFECCWNGKDSSIMTGSYNNFFRVF 2ABA_DROME 396 0 -
FDKFECVWNGSDSVIMTGSYNNFFRMF 2ABB_PIG 339 0 -
FDKFECDWSGDDKHILTGSYHNLFRSY P90851 383 0 -
FDKFECCLSGDGLRVATGSYSNLFRVF O82774 414 0 -
FDKFECCLSGDGLRVATGSYSNLFRVF Q39247 388 0 -
FDKFEVQFGGDNKSVMTGSYNNQFVIY 2ABA_CANTR 334 0 -
FDKFECTFSGDDKHVLSGSYSNNFGIY Q12702 342 0 -
FDKFECCISGNGLRAATGSYSNLFRVF Q38821 400 0 -
FDKFEVNFSGDSSSVMTGSYNNNFMIY 2ABA_YEAST 350 0 -

Motif 11 width=30
Element Seqn Id St Int Rpt
LDFSKKILHTAWHPSENIIAVAATNNLYIF 2ABB_HUMAN 409 43 -
LDFSKKILHTAWHPSENIIAVAATNNLYIF 2ABB_RAT 409 43 -
LDFSKKILHTAWHPSENIIAVAATNNLYIF P87345 434 43 -
LDFNKKILHTAWHPKENIIAVATTNNLYIF 2ABA_RAT 413 43 -
LDFNKKILHTAWHPKENIIAVATTNNLYIF 2ABA_HUMAN 413 43 -
LDFTKKILHTAWHPAENIIAIAATNNLYIF 2ABG_RABIT 409 43 -
LDFNKKILHTAWHPKENIIAVATTNNLYIF P97888 430 43 -
LDFNKKILHTAWHPEENIIAVAATNNLFIF 2ABA_DROME 466 43 -
LDFSKKILHTAWHPSENIIAVAATNNLYIF 2ABB_PIG 409 43 -
LQFDRKILHTAWHPKDNIIALAATNNLYIF P90851 463 53 -
YDLSTKLLHLAWHPTENSIACAAANSLYMY O82774 496 55 -
YDFTTKLLHMAWHPTENSIACAAANSLYMY Q39247 470 55 -
VDFKKSILHLSWHPRENSVAIAATNNLYIF 2ABA_CANTR 476 115 -
LDYNKKILHASWHPFEDSVAIAATNNLFVF Q12702 431 62 -
LDYTTKLLHLAWHPNENSIACAAANSLYMY Q38821 482 55 -
IDFKKNNLHFSWHPRENSIAVAATNNLFIF 2ABA_YEAST 494 117 -