SPRINT Home UMBER Home Contents Standard Search Advanced Search Relation Search

==SPRINT==> PRINTS View



  selected as


PR00432

Identifier
INTERLEUKIN5  [View Relations]  [View Alignment]  
Accession
PR00432
No. of Motifs
4
Creation Date
29-NOV-1995  (UPDATE 12-FEB-2000)
Title
Interleukin-5 signature
Database References

INTERPRO; IPR000186
PDB; 1BGC
SCOP; 1BGC
Literature References
1. CAMPBELL, H.D., TUCKER, W.Q., HORT, Y., MARTINSON, M.E., MAYO, G., 
CLUTTERBUCK, E.J., SANDERSON, C.J. AND YOUNG, I.G.
Molecular cloning, nucleotide sequence and expression of the gene encoding
human eosinophil differentiation factor (interleukin 5).
PROC.NATL.ACAD.SCI.U.S.A. 84 6629-6633 (1987).
 
2. MILBURN, M.V., HASSELL, A.M., LAMBERT, M.H., JORDAN, S.R., PROUDFOOT, 
A.E.I., GRABER, P. AND WELLS, T.N.
A novel dimer configuration revealed by the crystal structure at 2.4A
resolution of human interleukin-5.
NATURE 363 172-176 (1993).
 
3. PROUDFOOT, A.E.I., DAVIES, J.G., TURCATTI, G. AND WINGFIELD, P.T.
Human interleukin-5 expressed in Escherichia coli: assignment of the
disulfide bridges of the purified unglycosylated protein.
FEBS LETT. 283 61-64 (1991).

Documentation
Interleukin-5 (IL5), also known as eosinophil differentiation factor (EDF),
is a lineage-specific cytokine for eosinophilpoiesis [1,2]. It regulates 
eosinophil growth and activation [1], and thus plays an important role in
diseases associated with increased levels of eosinophils, including asthma
[2]. 
 
IL5 has a similar overall fold to other cytokines (e.g., IL2, IL4 and GCSF)
[2], but while these exist as monomeric structures, IL5 is a homodimer. The
fold contains an anti-parallel 4-alpha-helix bundle with a left handed twist,
connected by a 2-stranded anti-parallel beta-sheet [2,3]. The monomers are
held together by 2 interchain disulphide bonds [3].
 
INTERLEUKIN5 is a 4-element fingerprint that provides a signature for the
interleukin-5 cytokines. The fingerprint was derived from an initial
alignment of 3 sequences: the motifs were drawn from conserved regions
spanning virtually the full alignment length - motif 1 encodes the first
helix; motif 2 spans the first beta-strand and the second helix; motif 3
encodes the third helix; and motif 4 spans the second beta-strand and the 
fourth helix. Two iterations on OWL26.3 were required to reach convergence,
at which point a true set comprising 7 sequences was identified.
 
An update on SPTR37_10f identified a true set of 11 sequences.
Summary Information
11 codes involving  4 elements
0 codes involving 3 elements
0 codes involving 2 elements
Composite Feature Index
411111111
30000
20000
1234
True Positives
IL5_BOVIN     IL5_CAVPO     IL5_CERTO     IL5_FELCA     
IL5_HORSE IL5_HUMAN IL5_MACMU IL5_MERUN
IL5_MOUSE IL5_RAT IL5_SHEEP
Sequence Titles
IL5_BOVIN   INTERLEUKIN-5 PRECURSOR (IL-5) (T-CELL REPLACING FACTOR) (TRF) (EOSINOPHIL DIFFERENTIATION FACTOR) - BOS TAURUS (BOVINE). 
IL5_CAVPO INTERLEUKIN-5 PRECURSOR (IL-5) (T-CELL REPLACING FACTOR) (TRF) (EOSINOPHIL DIFFERENTIATION FACTOR) - CAVIA PORCELLUS (GUINEA PIG).
IL5_CERTO INTERLEUKIN-5 PRECURSOR (IL-5) (T-CELL REPLACING FACTOR) (TRF) (EOSINOPHIL DIFFERENTIATION FACTOR) - CERCOCEBUS TORQUATUS ATYS (RED-CROWNED MANGABEY) (SOOTY MANGABEY).
IL5_FELCA INTERLEUKIN-5 PRECURSOR (IL-5) (T-CELL REPLACING FACTOR) (TRF) (EOSINOPHIL DIFFERENTIATION FACTOR) - FELIS SILVESTRIS CATUS (CAT).
IL5_HORSE INTERLEUKIN-5 PRECURSOR (IL-5) (T-CELL REPLACING FACTOR) (TRF) (EOSINOPHIL DIFFERENTIATION FACTOR) - EQUUS CABALLUS (HORSE).
IL5_HUMAN INTERLEUKIN-5 PRECURSOR (IL-5) (T-CELL REPLACING FACTOR) (TRF) (EOSINOPHIL DIFFERENTIATION FACTOR) (B CELL DIFFERENTIATION FACTOR I) - HOMO SAPIENS (HUMAN).
IL5_MACMU INTERLEUKIN-5 PRECURSOR (IL-5) (T-CELL REPLACING FACTOR) (TRF) (EOSINOPHIL DIFFERENTIATION FACTOR) - MACACA MULATTA (RHESUS MACAQUE).
IL5_MERUN INTERLEUKIN-5 PRECURSOR (IL-5) (T-CELL REPLACING FACTOR) (TRF) (EOSINOPHIL DIFFERENTIATION FACTOR) - MERIONES UNGUICULATUS (MONGOLIAN JIRD).
IL5_MOUSE INTERLEUKIN-5 PRECURSOR (IL-5) (T-CELL REPLACING FACTOR) (TRF) (B-CELL GROWTH FACTOR II) (BCGF-II) (EOSINOPHIL DIFFERENTIATION FACTOR) (CYTOTOXIC T LYMPHOCYTE INDUCER) - MUS MUSCULUS (MOUSE).
IL5_RAT INTERLEUKIN-5 PRECURSOR (IL-5) (T-CELL REPLACING FACTOR) (TRF) (B-CELL GROWTH FACTOR II) (BCGF-II) (EOSINOPHIL DIFFERENTIATION FACTOR) (CYTOTOXIC T LYMPHOCYTE INDUCER) - RATTUS NORVEGICUS (RAT).
IL5_SHEEP INTERLEUKIN-5 PRECURSOR (IL-5) (T-CELL REPLACING FACTOR) (TRF) (EOSINOPHIL DIFFERENTIATION FACTOR) - OVIS ARIES (SHEEP).
Scan History
OWL26_3    2  100  NSINGLE    
SPTR37_9f 2 13 NSINGLE
SPTR37_10f 3 50 NSINGLE
Initial Motifs
Motif 1  width=29
Element Seqn Id St Int Rpt
VYAIPTEIPTSALVKETLALLSTHRTLLI IL5_HUMAN 17 17 -
VWATAMEIPMSTVVKETLTQLSAHRALLT IL5_MOUSE 16 16 -
VWAIAMEIPMSTVVKETLIQLSTHRALLT IL5_RAT 15 15 -

Motif 2 width=29
Element Seqn Id St Int Rpt
ANETLRIPVPVHKNHQLCTEEIFQGIGTL IL5_HUMAN 46 0 -
SNETMRLPVPTHKNHQLCIGEIFQGLDIL IL5_MOUSE 45 0 -
SNETMRLPVPTHKNHQLCIGEIFQGLDIL IL5_RAT 44 0 -

Motif 3 width=29
Element Seqn Id St Int Rpt
ESQTVQGGTVERLFKNLSLIKKYIDGQKK IL5_HUMAN 75 0 -
KNQTVRGGTVEMLFQNLSLIKKYIDRQKE IL5_MOUSE 74 0 -
KNQTVRGGTVEILFQNLSLIKKYIDGQKE IL5_RAT 73 0 -

Motif 4 width=30
Element Seqn Id St Int Rpt
KCGEERRRVNQFLDYLQEFLGVMNTEWIIE IL5_HUMAN 104 0 -
KCGEERRRTRQFLDYLQEFLGVMSTEWAME IL5_MOUSE 103 0 -
KCGEERRKTRHFLDYLQEFLGVMSTEWAME IL5_RAT 102 0 -
Final Motifs
Motif 1  width=29
Element Seqn Id St Int Rpt
VYAIPTEIPTSALVKETLALLSTHRTLLI IL5_HUMAN 17 17 -
VCALAVESPMNRLVAETLTLLSTHRTLLI IL5_HORSE 17 17 -
VYAIPTEIPASALVKETLALLSTHRTLLI IL5_MACMU 17 17 -
MYAIPTEIPTSALVKETLTLLSTHRTLLI IL5_CERTO 17 17 -
VWAVALEIPMSAVVKETLIQLSTHRALLT IL5_MERUN 15 15 -
VCANAVESTMNRLVAETLTLLSSHRTLLI IL5_BOVIN 17 17 -
VWATAMEIPMSTVVKETLTQLSAHRALLT IL5_MOUSE 16 16 -
VCANAVESTMNRLVAETLTLLSTHQTLLI IL5_SHEEP 15 15 -
VWAIAMEIPMSTVVKETLIQLSTHRALLT IL5_RAT 15 15 -
VSAIAVQSPMNRLVAETLALLSTHRTLLI IL5_FELCA 17 17 -
CAIPKQSATLRALVRETLTLLSTHRTLLK IL5_CAVPO 18 18 -

Motif 2 width=29
Element Seqn Id St Int Rpt
ANETLRIPVPVHKNHQLCTEEIFQGIGTL IL5_HUMAN 46 0 -
GDGNLMIPTPEHKNHQLCIEEVFQGIDTL IL5_HORSE 46 0 -
ANETLRIPVPVHKNHQLCTEEIFQGIGTL IL5_MACMU 46 0 -
GNETLRIPVPVHKHHQLCTEEIFQGIGTL IL5_CERTO 46 0 -
SNETVRLPVPTHKNHQLCIGEIFQGLDIL IL5_MERUN 44 0 -
GDGNLMIPTPQHTNHQLCIEEVFQGIDTL IL5_BOVIN 46 0 -
SNETMRLPVPTHKNHQLCIGEIFQGLDIL IL5_MOUSE 45 0 -
GDGNLMIPTPQHTNHQLCIEEVFQGIDTL IL5_SHEEP 44 0 -
SNETMRLPVPTHKNHQLCIGEIFQGLDIL IL5_RAT 44 0 -
GDGNLMIPTPEHNNHQLCIEEVFQGIDTL IL5_FELCA 46 0 -
GNETLRISVPAHKNHQLCIEEIFQGIDTL IL5_CAVPO 47 0 -

Motif 3 width=29
Element Seqn Id St Int Rpt
ESQTVQGGTVERLFKNLSLIKKYIDGQKK IL5_HUMAN 75 0 -
KNQTVQGDAVAKLFQNLSLIKGYIDLQKK IL5_HORSE 75 0 -
ESQTVQGGTVERLFKNLSLIKKYIGGQKK IL5_MACMU 75 0 -
ESQTLQGGTVERLFKNLSLIKKYIDGQKK IL5_CERTO 75 0 -
KNQTARGGAVETLFQNLSLIKKYIDRQKE IL5_MERUN 73 0 -
KNQTAQGDAVKKIFQNLSLIKEYIDLQKR IL5_BOVIN 75 0 -
KNQTVRGGTVEMLFQNLSLIKKYIDRQKE IL5_MOUSE 74 0 -
KNQTAQGDAVKKIFRNLSLIKEYIDLQKR IL5_SHEEP 73 0 -
KNQTVRGGTVEILFQNLSLIKKYIDGQKE IL5_RAT 73 0 -
KNRTVPGDAVEKLFRNLSLIKEHIDRQKK IL5_FELCA 75 0 -
KNQTTQGEALATLFQNLSLIKKHIDLQKQ IL5_CAVPO 76 0 -

Motif 4 width=30
Element Seqn Id St Int Rpt
KCGEERRRVNQFLDYLQEFLGVMNTEWIIE IL5_HUMAN 104 0 -
KCGGERWRVKQFLDYLQEFLGVINTEWTIE IL5_HORSE 104 0 -
KCGEERRRVNQFLDYLQEFLGVMNTEWIIE IL5_MACMU 104 0 -
KCGEERRRVNQFLDYLQEFLGVMNTEWIIE IL5_CERTO 104 0 -
KCGEERRRARQFLDYLQEFLGVMSTEWTME IL5_MERUN 102 0 -
KCGGERWRVKQFLDYLQVFLGVINTEWTME IL5_BOVIN 104 0 -
KCGEERRRTRQFLDYLQEFLGVMSTEWAME IL5_MOUSE 103 0 -
KCGGERWRVKQFLDYLQVFLGVINTEWTME IL5_SHEEP 102 0 -
KCGEERRKTRHFLDYLQEFLGVMSTEWAME IL5_RAT 102 0 -
KCGGERWRVKKFLDYLQVFLGVINTEWTME IL5_FELCA 104 0 -
KCGEERRRVKQFLDYLQEFLAVINTEWTIE IL5_CAVPO 105 0 -