SPRINT Home UMBER Home Contents Standard Search Advanced Search Relation Search

==SPRINT==> PRINTS View



  selected as


PR00347

Identifier
THAUMATIN  [View Relations]  [View Alignment]  
Accession
PR00347
No. of Motifs
6
Creation Date
10-JAN-1994  (UPDATE 04-JUL-1999)
Title
Pathogenesis-related protein signature
Database References

PROSITE; PS00316 THAUMATIN
BLOCKS; BL00316
PFAM; PF00314 thaumatin
INTERPRO; IPR001938
PDB; 1THI
SCOP; 1THI
Literature References
1. RUIZ-MEDRANO, R., JIMENEZ-MORAILA, B., HERRERA-ESTRELLA, L. AND
RIVERA-BUSTAMANTE, R.F.
Nucleotide sequence of an osmotin-like cDNA induced in tomato during viroid
infection.
PLANT MOL.BIOL. 20(6) 1199-1202 (1992).
 
2. EDENS, L., HESLINGA, L., KLOK, R., LEDEBOER, A.M., MAAT, J., TOONEN, M.Y.
VISSER, C. AND VERRIPS, C.T.
Cloning of cDNA encoding the sweet-tasting plant protein thaumatin and its
expression in Escherichia coli.
GENE 18(1) 1-12 (1982).
 
3. SINGH, N.K., NELSON, D.E., KUHN, D., HASEGAWA, P.M. AND BRESSAN, R.A.
Molecular cloning of osmotin and regulation of its expression by ABA and
adaption to low water potential.
PLANT PHYSIOL. 90(3) 1096-1101 (1989).
 
4. REBMANN, G., MAUCH, F. AND DUDLER, R.
Sequence of a wheat cDNA encoding a pathogen induced thaumatin-like protein.
PLANT MOL.BIOL. 16(6) 1089-1091 (1991).

Documentation
Pathogenesis related (PR) proteins, which are induced by various agents 
ranging from ethylene to pathogens, are structurally diverse and apparently
ubiquitous in plants [1]: they include thaumatin, osmotin, tobacco major
and minor PR proteins, alpha-amylase/trypsin inhibitor, and P21 and PWIR2
soybean and wheat leaf proteins. The proteins are involved in systematically
acquired resistance and stress response in plants, although their precise
role is unknown [1]. Thaumatin is an intensely sweet tasting protein
(about 100,000 times sweeter than sucrose [2]) found in the West African
shrub Thaumatacoccus danielli: it is induced by attack by viroids, which
are single-stranded unencapsulated RNA molecules that do not code for 
protein. Like other PR proteins, thaumatin is predicted to have a mainly
beta structure, with a high content of beta-turns and little helix [1].
 
Tobacco cells exposed to gradually increased salt concentrations develop a
greatly increased tolerance to salt, due to the expression of osmotin [3],
a member of the PR protein family. Wheat plants attacked by barley powdery
mildew express a PR protein (PWIR2), which results in resistance against
that infection [4]. The similarity between this and other PR proteins to
the maize alpha-amylase/trypsin inhibitor has suggested that PR proteins
may act as some form of inhibitor [4].
 
THAUMATIN is a 6-element fingerprint that provides a signature for
thaumatin and pathogenesis-related proteins. The fingerprint was derived
from an initial alignment of 6 sequences: the motifs were drawn from
conserved regions spanning the full alignment length, motif 4 including the
region encoded by PROSITE pattern THAUMATIN (PS00316), which contains 3
Cys residues known to be involved in disulphide bond formation. Two
iterations on OWL22.1 were required to reach convergence, at which point
a true set comprising 22 sequences was identified. Two partial matches
were also found, both of which are osmotin-like proteins that fail to make
significant matches with motifs 2 and 4.
 
An update on SPTR37_9f identified a true set of 32 sequences, and 22
partial matches.
Summary Information
  32 codes involving  6 elements
1 codes involving 5 elements
11 codes involving 4 elements
5 codes involving 3 elements
4 codes involving 2 elements
Composite Feature Index
6323232323232
5110111
482114118
3505050
2401021
123456
True Positives
IAAT_MAIZE    O04708        O23997        O24468        
O81927 O82087 OLPA_TOBAC OS13_SOLCO
OS35_SOLCO OS81_SOLCO OSL3_ARATH OSMO_TOBAC
P21_SOYBN P93621 PR1A_HORVU PR1C_HORVU
PR5_ARATH PRR1_TOBAC PRR2_TOBAC Q38769
Q40428 Q40529 Q41584 RST1_AVESA
RST2_AVESA RST3_AVESA RST4_AVESA THM1_THADA
THM2_THADA TLP_ORYSA TLP_WHEAT ZEAM_MAIZE
True Positive Partials
Codes involving 5 elements
O04364
Codes involving 4 elements
O04363 O49965 O65638 O80327
OLP1_LYCES Q19874 Q19876 Q38745
Q38746 TLPH_ARATH TLP_PRUAV
Codes involving 3 elements
O22973 O45533 O48830 O82546
Q19875
Codes involving 2 elements
O04521 O49728 O65637 Q38925
Sequence Titles
IAAT_MAIZE  ALPHA-AMYLASE/TRYPSIN INHIBITOR (ANTIFUNGAL PROTEIN) - ZEA MAYS (MAIZE). 
O04708 VVTL1 - VITIS VINIFERA (GRAPE).
O23997 BASIC PATHOGENESIS-RELATED PROTEIN PR5 PRECURSOR - HORDEUM VULGARE (BARLEY).
O24468 THAUMATIN-LIKE PROTEIN - ARABIDOPSIS THALIANA (MOUSE-EAR CRESS).
O81927 THAUMATIN-LIKE PROTEIN PR-5A PRECURSOR - CICER ARIETINUM (CHICKPEA) (GARBANZO).
O82087 PATHOGENESIS RELATED PROTEIN-5 - ZEA MAYS (MAIZE).
OLPA_TOBAC OSMOTIN-LIKE PROTEIN PRECURSOR (PATHOGENESIS-RELATED PROTEIN PR-5D) - NICOTIANA TABACUM (COMMON TOBACCO).
OS13_SOLCO OSMOTIN-LIKE PROTEIN OSML13 PRECURSOR (PA13) - SOLANUM COMMERSONII (COMMERSON'S WILD POTATO).
OS35_SOLCO OSMOTIN-LIKE PROTEIN OSML15 PRECURSOR (PA15) - SOLANUM COMMERSONII (COMMERSON'S WILD POTATO).
OS81_SOLCO OSMOTIN-LIKE PROTEIN OSML81 PRECURSOR (PA81) - SOLANUM COMMERSONII (COMMERSON'S WILD POTATO).
OSL3_ARATH OSMOTIN-LIKE PROTEIN OSM34 PRECURSOR - ARABIDOPSIS THALIANA (MOUSE-EAR CRESS).
OSMO_TOBAC OSMOTIN PRECURSOR - NICOTIANA TABACUM (COMMON TOBACCO).
P21_SOYBN P21 PROTEIN - GLYCINE MAX (SOYBEAN).
P93621 OSMOTIN-LIKE PROTEIN PRECURSOR - VITIS VINIFERA (GRAPE).
PR1A_HORVU PATHOGENESIS-RELATED PROTEIN 1A/1B PRECURSOR - HORDEUM VULGARE (BARLEY).
PR1C_HORVU PATHOGENESIS-RELATED PROTEIN 1C PRECURSOR - HORDEUM VULGARE (BARLEY).
PR5_ARATH PATHOGENESIS-RELATED PROTEIN 5 PRECURSOR (PR-5) - ARABIDOPSIS THALIANA (MOUSE-EAR CRESS).
PRR1_TOBAC PATHOGENESIS-RELATED PROTEIN R MAJOR FORM PRECURSOR (THAUMATIN-LIKE PROTEIN E22) - NICOTIANA TABACUM (COMMON TOBACCO).
PRR2_TOBAC PATHOGENESIS-RELATED PROTEIN R MINOR FORM PRECURSOR (PR-R) (PROB12) (THAUMATIN-LIKE PROTEIN E2) - NICOTIANA TABACUM (COMMON TOBACCO).
Q38769 PERMATIN PRECURSOR - AVENA SATIVA (OAT).
Q40428 NEUTRAL PR-5 (OSMOTIN-LIKE PROTEIN, PR-5D) - NICOTIANA SYLVESTRIS (WOOD TOBACCO).
Q40529 OSMOTIN - NICOTIANA TABACUM (COMMON TOBACCO).
Q41584 THAUMATIN-LIKE PROTEIN - TRITICUM AESTIVUM (WHEAT).
RST1_AVESA THAUMATIN-LIKE PATHOGENESIS-RELATED PROTEIN 1 PRECURSOR - AVENA SATIVA (OAT).
RST2_AVESA THAUMATIN-LIKE PATHOGENESIS-RELATED PROTEIN 2 PRECURSOR - AVENA SATIVA (OAT).
RST3_AVESA THAUMATIN-LIKE PATHOGENESIS-RELATED PROTEIN 3 PRECURSOR - AVENA SATIVA (OAT).
RST4_AVESA THAUMATIN-LIKE PATHOGENESIS-RELATED PROTEIN 4 PRECURSOR - AVENA SATIVA (OAT).
THM1_THADA THAUMATIN I - THAUMATOCOCCUS DANIELLII (KATEMFE).
THM2_THADA THAUMATIN II PRECURSOR - THAUMATOCOCCUS DANIELLII (KATEMFE).
TLP_ORYSA THAUMATIN-LIKE PROTEIN PRECURSOR - ORYZA SATIVA (RICE).
TLP_WHEAT THAUMATIN-LIKE PROTEIN PWIR2 PRECURSOR - TRITICUM AESTIVUM (WHEAT).
ZEAM_MAIZE ZEAMATIN PRECURSOR - ZEA MAYS (MAIZE).

O04364 PATHOGENESIS-RELATED THAUMATIN-LIKE PROTEIN - ORYZA SATIVA (RICE).

O04363 PATHOGENESIS-RELATED THAUMATIN-LIKE PROTEIN - ORYZA SATIVA (RICE).
O49965 PATHOGENESIS-RELATED GROUP 5 PROTEIN - BRASSICA RAPA (TURNIP).
O65638 THAUMATIN-LIKE PROTEIN - ARABIDOPSIS THALIANA (MOUSE-EAR CRESS).
O80327 THAUMATIN-LIKE PROTEIN PRECURSOR - PYRUS PYRIFOLIA (JAPANESE PEAR).
OLP1_LYCES OSMOTIN-LIKE PROTEIN PRECURSOR - LYCOPERSICON ESCULENTUM (TOMATO).
Q19874 F28D1.3 PROTEIN - CAENORHABDITIS ELEGANS.
Q19876 F28D1.5 PROTEIN - CAENORHABDITIS ELEGANS.
Q38745 OSMOTIN-LIKE PROTEIN - ATRIPLEX NUMMULARIA.
Q38746 OSMOTIN-LIKE PROTEIN - ATRIPLEX NUMMULARIA.
TLPH_ARATH THAUMATIN-LIKE PROTEIN PRECURSOR - ARABIDOPSIS THALIANA (MOUSE-EAR CRESS).
TLP_PRUAV THAUMATIN-LIKE PROTEIN PRECURSOR - PRUNUS AVIUM (CHERRY).

O22973 THAUMATIN ISOLOG - ARABIDOPSIS THALIANA (MOUSE-EAR CRESS).
O45533 F49A5.6 PROTEIN - CAENORHABDITIS ELEGANS.
O48830 PUTATIVE THAUMATIN-LIKE PATHOGENESIS-RELATED PROTEIN - ARABIDOPSIS THALIANA (MOUSE-EAR CRESS).
O82546 THAUMATIN-LIKE PROTEIN PRECURSOR MDTL1 - MALUS DOMESTICA (APPLE) (MALUS SYLVESTRIS).
Q19875 F28D1.4 PROTEIN - CAENORHABDITIS ELEGANS.

O04521 SIMILARITY TO ARABIDOPSIS RECEPTOR PROTEIN KINASE PR5K - ARABIDOPSIS THALIANA (MOUSE-EAR CRESS).
O49728 RECEPTOR SERINE/THREONINE KINASE-LIKE PROTEIN - ARABIDOPSIS THALIANA (MOUSE-EAR CRESS).
O65637 THAUMATIN-LIKE PROTEIN - ARABIDOPSIS THALIANA (MOUSE-EAR CRESS).
Q38925 RECEPTOR SERINE/THREONINE KINASE PR5K - ARABIDOPSIS THALIANA (MOUSE-EAR CRESS).
Scan History
OWL22_1    2  100  NSINGLE    
OWL26_0 1 100 NSINGLE
SPTR37_9f 2 72 NSINGLE
Initial Motifs
Motif 1  width=13
Element Seqn Id St Int Rpt
TFNIKNNCGFTIW TLP_WHEAT 22 22 -
VFEVHNNCPYTVW OLPA_TOBAC 24 24 -
TIEVRNNCPYTVW OSMO_TOBAC 23 23 -
TFEIVNRCSYTVW NRL_1THI 2 2 -
TFEVRNNCPYTVW TPM1_LYCES 15 15 -
TFEIVNRCSYTVW THM2_THADA 24 24 -

Motif 2 width=10
Element Seqn Id St Int Rpt
GGFALGSGQT TLP_WHEAT 42 7 -
GGRRLDRGQT TPM1_LYCES 35 7 -
GGRQLNSGES NRL_1THI 27 12 -
GGRRLDRGQT OSMO_TOBAC 43 7 -
GGRRLERGQS OLPA_TOBAC 44 7 -
GGRQLNSGES THM2_THADA 49 12 -

Motif 3 width=12
Element Seqn Id St Int Rpt
KIWARTDCYFDD THM2_THADA 71 12 -
KIWARTDCYFDD NRL_1THI 49 12 -
RIWGRTNCNFDG TPM1_LYCES 57 12 -
RVWGRTNCNFNA OSMO_TOBAC 65 12 -
RIWGRTNCNFDG OLPA_TOBAC 66 12 -
RIWARTGCSFNG TLP_WHEAT 64 12 -

Motif 4 width=30
Element Seqn Id St Int Rpt
GRGTCQTGDCGGVLQCTGWGKPPNTLAEYA OSMO_TOBAC 78 1 -
GSGICKTGDCGGLLRCKRFGRPPTTLAEFS NRL_1THI 62 1 -
GRGSCQTGDCGGVLQCTGWGKPPNTLAEYA TPM1_LYCES 70 1 -
GRGWCQTGDCGGVLECKGWGKPPNTLAEYA OLPA_TOBAC 79 1 -
GRGICRTGDCGGLLQCKRFGRPPTTLAEFS THM2_THADA 84 1 -
GSGSCQTGDCGGQLSCSLSGRPPATLAEYT TLP_WHEAT 76 0 -

Motif 5 width=17
Element Seqn Id St Int Rpt
DFWDISLVDGFNIPMTF TPM1_LYCES 107 6 -
DFWDISLLDGFNIPITF OSMO_TOBAC 115 6 -
DFWDISVIDGFNIPMSF OLPA_TOBAC 116 6 -
DFYDISVIDGFNLAMDF TLP_WHEAT 113 6 -
DYIDISNIKGFNVPMDF THM2_THADA 120 5 -
DYIDISNIKGFNVPMNF NRL_1THI 98 5 -

Motif 6 width=10
Element Seqn Id St Int Rpt
GSSNYRVTFC NRL_1THI 195 80 -
GSSNYRVTFC THM2_THADA 217 80 -
GNNNYQITFC TLP_WHEAT 163 33 -
WTTDYKVMFC OLPA_TOBAC 217 84 -
GSTNYRVVFC TPM1_LYCES 208 84 -
GSTNYRVIFC OSMO_TOBAC 213 81 -
Final Motifs
Motif 1  width=13
Element Seqn Id St Int Rpt
TIEVRNNCPYTVW OS13_SOLCO 23 23 -
TIEVRNNCPYTVW OS81_SOLCO 23 23 -
TFDIVNQCTYTVW PRR2_TOBAC 27 27 -
TFEILNQCSYTVW OSL3_ARATH 24 24 -
TFDIVNKCTYTVW PRR1_TOBAC 27 27 -
TIEVRNNCPYTVW Q40529 23 23 -
TIEVRNNCPYTVW OSMO_TOBAC 23 23 -
VFTVVNQCPFTVW ZEAM_MAIZE 23 23 -
VFEVHNNCPYTVW OLPA_TOBAC 24 24 -
VFEVHNNCPYTVW OS35_SOLCO 24 24 -
VFEVHNNCPYTVW Q40428 24 24 -
RFEITNRCTYTVW P21_SOYBN 2 2 -
TFDILNKCTYTVW O04708 26 26 -
TFTITNNCGFTVW O82087 25 25 -
TFTITNRCSFTVW TLP_ORYSA 28 28 -
TFNIQNHCSYTVW P93621 26 26 -
TFNIKNNCGFTIW TLP_WHEAT 22 22 -
TFNIKNNCGSTIW PR1A_HORVU 22 22 -
TFNIKNNCGSTIW PR1C_HORVU 22 22 -
RFDIVNQCSYNVW O81927 22 22 -
TFRITNNCGFTVW RST1_AVESA 23 23 -
TFNIKNNCPYTVW Q41584 27 27 -
VFTVVNQCPFTVW IAAT_MAIZE 2 2 -
TFRITNNCGFTVW RST2_AVESA 23 23 -
TFRITNNCGFTVW RST3_AVESA 23 23 -
TFEIVNRCSYTVW THM2_THADA 24 24 -
TFEIVNRCSYTVW THM1_THADA 2 2 -
TFTITNNCGYTVW RST4_AVESA 23 23 -
TITVVNKCSYTVW Q38769 26 26 -
TITVVNRCSYTVW O23997 26 26 -
VFTLQNSCAYTVW O24468 25 25 -
DFTLRNNCPTTVW PR5_ARATH 25 25 -

Motif 2 width=10
Element Seqn Id St Int Rpt
GGRRLDRGQT OS13_SOLCO 43 7 -
GGRRLNKGQT OS81_SOLCO 43 7 -
GGRQLNSGQS PRR2_TOBAC 46 6 -
GGRRLDAGQS OSL3_ARATH 43 6 -
GGRRLDSGQS PRR1_TOBAC 46 6 -
GGRRLDRGQT Q40529 43 7 -
GGRRLDRGQT OSMO_TOBAC 43 7 -
GGRQLNRGES ZEAM_MAIZE 43 7 -
GGRRLERGQS OLPA_TOBAC 44 7 -
GGRRLERGQS OS35_SOLCO 44 7 -
GGRRLERGQS Q40428 44 7 -
GGVQLNPGQS P21_SOYBN 22 7 -
GGRRLDSGQS O04708 45 6 -
GGTQLNPGGT O82087 45 7 -
GGVQLSPGQT TLP_ORYSA 48 7 -
GGMQLGSGQS P93621 45 6 -
GGFALGSGQT TLP_WHEAT 42 7 -
GGFELGSGQT PR1A_HORVU 42 7 -
GGFELGSGQT PR1C_HORVU 42 7 -
GGRQLNPRET O81927 42 7 -
GGFQLNSKQS RST1_AVESA 43 7 -
GGRQLNTGET Q41584 47 7 -
GGRQLNRGES IAAT_MAIZE 22 7 -
GGFQLNSKQS RST2_AVESA 43 7 -
GGFQLNSKQS RST3_AVESA 43 7 -
GGRQLNSGES THM2_THADA 49 12 -
GGRQLNSGES THM1_THADA 27 12 -
GGQQLDQGQT RST4_AVESA 43 7 -
GGVRLDPGKS Q38769 45 6 -
GGVRLDPGQS O23997 45 6 -
GGFPLTPGAS O24468 51 13 -
GGFELTPGAS PR5_ARATH 51 13 -

Motif 3 width=12
Element Seqn Id St Int Rpt
RIWGRTNCNFDG OS13_SOLCO 65 12 -
RIWGRTGCNFNA OS81_SOLCO 65 12 -
RIWGRTNCNFDG PRR2_TOBAC 68 12 -
RIWGRTNCNFDS OSL3_ARATH 65 12 -
RIWGRTNCNFDG PRR1_TOBAC 68 12 -
RIWGRTNCNFNA Q40529 65 12 -
RVWGRTNCNFNA OSMO_TOBAC 65 12 -
RIWARTGCKFDA ZEAM_MAIZE 65 12 -
RIWGRTNCNFDG OLPA_TOBAC 66 12 -
RIWGRTNCNFDG OS35_SOLCO 66 12 -
RIWGRTNCNFDG Q40428 66 12 -
RVWARTGCNFDG P21_SOYBN 44 12 -
RIWGRTSCTFDA O04708 67 12 -
RVWGRTGCSFNG O82087 67 12 -
RVWGRTGCSFDG TLP_ORYSA 70 12 -
RVWGRTNCNFDA P93621 67 12 -
RIWARTGCSFNG TLP_WHEAT 64 12 -
RIWARTGCSFNG PR1A_HORVU 64 12 -
RIWARTGCSFNG PR1C_HORVU 64 12 -
RIWGRTGCNFDG O81927 64 12 -
RIWGRTGCSFNN RST1_AVESA 65 12 -
RVWGRTGCNFNG Q41584 69 12 -
RIWARTGCQFDA IAAT_MAIZE 44 12 -
RIWGRTGCSFNN RST2_AVESA 65 12 -
RIWGRTGCSFNN RST3_AVESA 65 12 -
KIWARTDCYFDD THM2_THADA 71 12 -
KIWARTDCYFDD THM1_THADA 49 12 -
RIWGRTGCSFNG RST4_AVESA 65 12 -
RVWPRTGCTFDA Q38769 67 12 -
RVWPRTGCTFDG O23997 67 12 -
RFWARTGCNFDA O24468 72 11 -
RFWARTGCNFDA PR5_ARATH 72 11 -

Motif 4 width=30
Element Seqn Id St Int Rpt
GRGSCQTGDCGGVLQCTGWGKPPNTLAEYA OS13_SOLCO 78 1 -
GRGSCQTGDCGGVLQCTGWGKPPNTLAEYA OS81_SOLCO 78 1 -
GRGNCETGDCNGMLECQGYGKPPNTLAEFA PRR2_TOBAC 81 1 -
GRGRCQTGDCSGGLQCTGWGQPPNTLAEYA OSL3_ARATH 78 1 -
GRGNCETGDCNGMLECQGYGKAPNTLAEFA PRR1_TOBAC 81 1 -
GRGTCQTGDCGGVLQCTGWGKPPNTLAEYA Q40529 78 1 -
GRGTCQTGDCGGVLQCTGWGKPPNTLAEYA OSMO_TOBAC 78 1 -
GRGSCRTGDCGGVLQCTGYGRAPNTLAEYA ZEAM_MAIZE 78 1 -
GRGWCQTGDCGGVLECKGWGKPPNTLAEYA OLPA_TOBAC 79 1 -
GRGWCQTGDCGGVLECKGWGKPPNTLAEYA OS35_SOLCO 79 1 -
GRGWCQTGDCGGVLECKGWGKPPNTLAEYA Q40428 79 1 -
GRGGCQTGDCGGVLDCKAYGAPPNTLAEYG P21_SOYBN 57 1 -
GRGKCETGDCNGLLECQGYGSPPNTLAEFA O04708 80 1 -
NSGSCQTGDCGGALACTLSGQPPLTLAEFT O82087 79 0 -
GRGSCATGDCAGALSCTLSGQKPLTLAEFT TLP_ORYSA 83 1 -
GNGKCETGDCGGLLQCTAYGTPPNTLAEFA P93621 80 1 -
GSGSCQTGDCGGQLSCSLSGRPPATLAEYT TLP_WHEAT 76 0 -
GSGSCQTGDCGGQLSCSLSGQPPATLAEFT PR1A_HORVU 76 0 -
GSGSCQTGDCGGQLSCSLSGRPPATLAEFT PR1C_HORVU 76 0 -
GRGSCQTGDCGGDLSCHLSGQPPTTLAEFS O81927 77 1 -
GRGSCATGDCAGALSCTLSGQPATLAEYTI RST1_AVESA 77 0 -
NSGSCQTADCGGALSCTLSGQPPLTLAEFT Q41584 81 0 -
GRGSCRTGDCGGVVQCTGYGRAPNTLAEYA IAAT_MAIZE 57 1 -
GRGSCATGDCAGALSCTLSGQPATLAEYTI RST2_AVESA 77 0 -
GRGSCATGDCAGALSCTLSGQPATLAEYTI RST3_AVESA 77 0 -
GRGICRTGDCGGLLQCKRFGRPPTTLAEFS THM2_THADA 84 1 -
GSGICKTGDCGGLLRCKRFGRPPTTLAEFS THM1_THADA 62 1 -
GSGSCQTGDCAGALSCTLSGQPATLAEFSI RST4_AVESA 77 0 -
GRGHCVTGDCGGALACRVSGQQPATLAEYT Q38769 80 1 -
GRGRCITGDCNGVLACRVSGQQPTTLAEYT O23997 80 1 -
GHGTCVTGDCGGVLKCTGGGVPPATLAEFT O24468 85 1 -
SGNGRCVTGDCGGLRCNGGGVPPVTLAEFT PR5_ARATH 84 0 -

Motif 5 width=17
Element Seqn Id St Int Rpt
DFWDISLVDGFNIPMTF OS13_SOLCO 115 7 -
DFWDISLVDGFNIPMTF OS81_SOLCO 115 7 -
DFVDISLVDGFNIPMEF PRR2_TOBAC 117 6 -
DFYDISLVDGFNIPMEF OSL3_ARATH 115 7 -
DFVDISLVDGFNIPMEF PRR1_TOBAC 117 6 -
DFWDISLVDGFNIPMTF Q40529 115 7 -
DFWDISLLDGFNIPITF OSMO_TOBAC 115 6 -
DFFDISLIDGFNVPMSF ZEAM_MAIZE 115 7 -
DFWDISVIDGFNIPMSF OLPA_TOBAC 116 6 -
DFWDISVIDGFNIPMSF OS35_SOLCO 116 7 -
DFWDISVIDGFNIPMSF Q40428 116 7 -
DFFDISLVDGFNVPMDF P21_SOYBN 94 7 -
DYIDISLVDGFNIPMDF O04708 117 7 -
DFYDISVIDGYNLAMAF O82087 114 5 -
DFYDLSVIDGYNVAMSF TLP_ORYSA 118 5 -
DFFDISLVDGFNVPMAF P93621 117 7 -
DFYDISVIDGFNLAMDF TLP_WHEAT 113 6 -
DFYDISVIDGFNLAMDF PR1A_HORVU 113 7 -
DFYDISVIDGFNLAMDF PR1C_HORVU 113 7 -
DYFDISVIDGFNIPMQF O81927 114 7 -
DFYDISVIDGFNLAMDF RST1_AVESA 111 4 -
DFYDISVIDGFNVPLSF Q41584 116 5 -
DFFDISILDGFNVPYSF IAAT_MAIZE 94 7 -
DFYDISVIDGYNLAMDF RST2_AVESA 111 4 -
DFYDISVIDGYNLAMDF RST3_AVESA 111 4 -
DYIDISNIKGFNVPMDF THM2_THADA 120 5 -
DYIDISNIKGFNVPMNF THM1_THADA 98 6 -
DYYDISVIDVYNLAMDF RST4_AVESA 111 4 -
DFFDLSVIDGFNVPMSF Q38769 117 7 -
DFFDLSVIDGFNVPMSF O23997 117 7 -
DFYDVSLVDGYNVKMGI O24468 123 8 -
DFYDVSLVDGYNVKLGI PR5_ARATH 121 7 -

Motif 6 width=10
Element Seqn Id St Int Rpt
GSTNYRVVFC OS13_SOLCO 216 84 -
GSTNYRVVFC OS81_SOLCO 216 84 -
PGTNYRVVFC PRR2_TOBAC 216 82 -
TNTNYRVVFC OSL3_ARATH 213 81 -
SGTNYRVVFC PRR1_TOBAC 216 82 -
GSTNYKVIFC Q40529 216 84 -
GSTNYRVIFC OSMO_TOBAC 213 81 -
AGTNYKVVFC ZEAM_MAIZE 217 85 -
WTTDYKVMFC OLPA_TOBAC 217 84 -
WTTDYKVMFC OS35_SOLCO 217 84 -
WTTDYKVMFC Q40428 217 84 -
GGTDYRVVFC P21_SOYBN 192 81 -
SGTNYKVTFC O04708 212 78 -
GNSNYQVTFC O82087 162 31 -
GNSNYQVVFC TLP_ORYSA 167 32 -
AGTNYEVIFC P93621 215 81 -
GNNNYQITFC TLP_WHEAT 163 33 -
GNNNYQITFC PR1A_HORVU 163 33 -
GNNNYQITFC PR1C_HORVU 163 33 -
GGTNYRIVFC O81927 165 34 -
GNSNYQITFC RST1_AVESA 159 31 -
NNNTYQVTFC Q41584 166 33 -
AGTNYKVVFC IAAT_MAIZE 196 85 -
GNSNYQITFC RST2_AVESA 159 31 -
GNSNYQITFC RST3_AVESA 159 31 -
GSSNYRVTFC THM2_THADA 217 80 -
GSSNYRVTFC THM1_THADA 195 80 -
TNSNYQITFC RST4_AVESA 159 31 -
VGTNYQIVLC Q38769 218 84 -
AGTNYQIVLP O23997 215 81 -
TGSNYLITFC O24468 232 92 -
TGANYEITFC PR5_ARATH 229 91 -