SPRINT Home UMBER Home Contents Standard Search Advanced Search Relation Search

==SPRINT==> PRINTS View



  selected as


PR00291

Identifier
KUNITZINHBTR  [View Relations]  [View Alignment]  
Accession
PR00291
No. of Motifs
4
Creation Date
14-OCT-1992  (UPDATE 28-JUL-1999)
Title
Soybean trypsin inhibitor (Kunitz-type) signature
Database References

PROSITE; PS00283 SOYBEAN_KUNITZ
BLOCKS; BL00283
PFAM; PF00197 Kunitz_legume
INTERPRO; IPR002160
PDB; 1TIE
SCOP; 1TIE
CATH; 1TIE
Literature References
1. GARCIA-OLMEDO, F., SALCEDO, G., SANCHEZ-MONGE, R., GOMEZ, L., ROYO, J.
AND CARBONERO, P.  
Plant proteinaceous inhibitors of proteinases and alpha-amylases. 
OXFORD SURVEYS OF PLANT MOL. & CELL.BIOL. 4 275-334 (1987).
 
2. ONESTI, S., BRICK, P. AND BLOW, D.M.  
Crystal structure of a Kunitz-type trypsin inhibitor from Erythrina 
caffra seeds. 
J.MOL.BIOL. 217 153-176 (1991).
 
3. MURZIN, A.G., LESK, A.M. AND CHOTHIA, C.  
Patterns of structure and sequence in the Kunitz inhibitors, interleukins-1
beta and 1 alpha and fibroblast growth factors. 
J.MOL.BIOL. 223 531-543 (1992).

Documentation
The Kunitz-type soybean trypsin inhibitor (STI) family consists mainly of
inhibitors of trypsin and other serine proteases from Leguminosae seeds 
[1]. The STIs belong to a superfamily that also contains the interleukin-1 
proteins, heparin binding growth factors (HBGF) and histactophilin, all of 
which have very similar structures, but share no sequence similarity with 
the STI family.
 
Inhibitors from cereals are active against subtilisin and endogenous
alpha-amylases, while some also inhibit tissue plasminogen activator. 
The inhibitors are usually specific for either trypsin or chymotrypsin, and
some are effective against both. They are thought to protect the seeds
against consumption by animal predators, while at the same time existing as
seed storage proteins themselves - all the actively inhibitory members
contain 2 disulphide bridges. The existence of a member with no
inhibitory activity, winged bean albumin 1, suggests that the inhibitors
may have evolved from seed storage proteins.
                                  
The crystal structures of soybean trypsin inhibitor (STI), trypsin 
inhibitor DE-3 from Erythrina caffra (ETI) [2] and the bifunctional 
proteinase K/alpha-amylase inhibitor from wheat (PK13) have been solved,
showing them to share the same 12-stranded beta-sheet structure as those 
of interleukin-1 and heparin-binding growth factors [3]. The beta-sheets
are arranged in 3 similar lobes around a central axis, 6 strands forming 
an anti-parallel beta-barrel. Despite the structural similarity, STI shows
no interleukin-1 bioactivity, presumably as a result of their primary 
sequence disparities. The active inhibitory site containing the scissile 
bond is located in the loop between beta-strands 4 and 5 in STI and ETI.
                                  
KUNITZINHBTR is a 4-element fingerprint that provides a signature for the
Kunitz-type soybean trypsin inhibitors. The fingerprint was derived from 
an initial alignment of 4 sequences, the motifs being drawn from the beta-
sheet regions, which are generally more conserved than the loops between 
them: motif 1 spans the N-terminus and strands 1 and 2; motif 2 spans 
strands 3 and 4; motif 3 strands 8 and 9; and motif 4 strands 10 and 12.
Three iterations on OWL17.1 were required to reach convergence, at which
point most of the known members of the family were identified. 
 
An update on SPTR37_9f identified a true set of 51 sequences, and 12
partial matches.
Summary Information
  51 codes involving  4 elements
3 codes involving 3 elements
9 codes involving 2 elements
Composite Feature Index
451515151
33303
29711
1234
True Positives
ASP_THECC     IAAS_HORVU    IAAS_WHEAT    IAP2_SOLTU    
IAP_SOLTU ICTC_SOLTU ICTD_SOLTU ICW3_PSOTE
IDE3_ERYCA IDE3_ERYLA IDE3_ERYVA IECI_ERYVA
IT1A_PSOTE IT1B_ERYVA IT1B_PSOTE IT2_PSOTE
ITRA_SOYBN ITRB_SOYBN KTI1_SOYBN KTI2_SOYBN
MIRA_RICDU O48625 O82711 P93378
Q08332 Q39369 Q39869 Q39898
Q39899 Q40023 Q40083 Q40084
Q40085 Q40091 Q40092 Q41015
Q41153 Q41433 Q41448 Q41480
Q41481 Q41482 Q41483 Q41484
Q43646 Q43708 Q43721 SPR1_IPOBA
SPR2_IPOBA SPRA_IPOBA SPRB_IPOBA
True Positive Partials
Codes involving 3 elements
ITRY_ACACO LSPI_CARPA Q39091
Codes involving 2 elements
ALB1_PSOTE IAAS_ORYSA ID5A_ADEPA ID5A_PROJU
ITC_ALOMA Q40129 Q41505 Q42436
Q96230
Sequence Titles
ASP_THECC   21 KD SEED PROTEIN PRECURSOR - THEOBROMA CACAO (CACAO). 
IAAS_HORVU ALPHA-AMYLASE/SUBTILISIN INHIBITOR PRECURSOR (BASI) - HORDEUM VULGARE (BARLEY).
IAAS_WHEAT ENDOGENOUS ALPHA-AMYLASE/SUBTILISIN INHIBITOR (WASI) - TRITICUM AESTIVUM (WHEAT).
IAP2_SOLTU ASPARTIC PROTEINASE INHIBITOR PRECURSOR (PIG) - SOLANUM TUBEROSUM (POTATO).
IAP_SOLTU CATHEPSIN D INHIBITOR PRECURSOR (NDI) - SOLANUM TUBEROSUM (POTATO).
ICTC_SOLTU WOUND-INDUCED ASPARTATE PROTEINASE CDI INHIBITOR PRECURSOR - SOLANUM TUBEROSUM (POTATO).
ICTD_SOLTU CATHEPSIN D INHIBITOR (PDI) - SOLANUM TUBEROSUM (POTATO).
ICW3_PSOTE CHYMOTRYPSIN INHIBITOR 3 PRECURSOR (WCI-3) - PSOPHOCARPUS TETRAGONOLOBUS (GOA BEAN) (ASPARAGUS BEAN).
IDE3_ERYCA TRYPSIN INHIBITOR DE-3 - ERYTHRINA CAFFRA (KAFFIR TREE).
IDE3_ERYLA TRYPSIN INHIBITOR DE-3 - ERYTHRINA LATISSIMA (CORAL BEAN), AND ERYTHRINA CORALLODENDRON (CORAL TREE).
IDE3_ERYVA TRYPSIN INHIBITOR DE-3 (ETIA) - ERYTHRINA VARIEGATA.
IECI_ERYVA CHYMOTRYPSIN INHIBITOR ECI - ERYTHRINA VARIEGATA.
IT1A_PSOTE TRYPSIN INHIBITOR 1A (WTI-1A) - PSOPHOCARPUS TETRAGONOLOBUS (GOA BEAN) (ASPARAGUS BEAN).
IT1B_ERYVA TRYPSIN INHIBITOR 1B (ETIB) - ERYTHRINA VARIEGATA.
IT1B_PSOTE TRYPSIN INHIBITOR 1B (WTI-1B) - PSOPHOCARPUS TETRAGONOLOBUS (GOA BEAN) (ASPARAGUS BEAN).
IT2_PSOTE TRYPSIN INHIBITOR 2 (WTI-2) - PSOPHOCARPUS TETRAGONOLOBUS (GOA BEAN) (ASPARAGUS BEAN).
ITRA_SOYBN TRYPSIN INHIBITORS A/C PRECURSOR (KUNITZ) - GLYCINE MAX (SOYBEAN).
ITRB_SOYBN TRYPSIN INHIBITOR B (KUNITZ) - GLYCINE MAX (SOYBEAN).
KTI1_SOYBN KUNITZ-TYPE TRYPSIN INHIBITOR KTI1 PRECURSOR - GLYCINE MAX (SOYBEAN).
KTI2_SOYBN KUNITZ-TYPE TRYPSIN INHIBITOR KTI2 PRECURSOR - GLYCINE MAX (SOYBEAN).
MIRA_RICDU MIRACULIN PRECURSOR (MIR) - RICHADELLA DULCIFICA (MIRACLE FRUIT) (SYNSEPALUM DULCIFICUM).
O48625 LEMIR - LYCOPERSICON ESCULENTUM (TOMATO).
O82711 PROFUCOSIDASE PRECURSOR (EC 3.2.1.51) - PISUM SATIVUM (GARDEN PEA).
P93378 TUMOR-RELATED PROTEIN - NICOTIANA TABACUM (COMMON TOBACCO).
Q08332 CATHEPSIN D INHIBITOR PRECURSOR (NDI) - LYCOPERSICON ESCULENTUM (TOMATO).
Q39369 TRYPSIN INHIBITOR PROPEPTIDE PRECURSOR - BRASSICA OLERACEA (CAULIFLOWER).
Q39869 KUNITZ TRYPSIN INHIBITOR PRECURSOR - GLYCINE MAX (SOYBEAN).
Q39898 TRYPSIN INHIBITOR SUBTYPE A PRECURSOR - GLYCINE MAX (SOYBEAN).
Q39899 TRYPSIN INHIBITOR SUBTYPE B PRECURSOR - GLYCINE MAX (SOYBEAN).
Q40023 BIFUNCTIONAL ALPHA-AMYLASE/SUBTILISIN INHIBITOR PRECURSOR - HORDEUM VULGARE (BARLEY).
Q40083 PREPROSPORAMIN PRECURSOR - IPOMOEA BATATAS (SWEET POTATO) (BATATE).
Q40084 SPORAMIN PRECURSOR - IPOMOEA BATATAS (SWEET POTATO) (BATATE).
Q40085 SPORAMIN PRECURSOR - IPOMOEA BATATAS (SWEET POTATO) (BATATE).
Q40091 SPORAMIN B - IPOMOEA BATATAS (SWEET POTATO) (BATATE).
Q40092 SPORAMIN A PRECURSOR - IPOMOEA BATATAS (SWEET POTATO) (BATATE).
Q41015 ALPHA-FUCOSIDASE - PISUM SATIVUM (GARDEN PEA).
Q41153 MIRACULIN PRECURSOR (MIR) - RICHADELLA DULCIFICA (MIRACLE FRUIT) (SYNSEPALUM DULCIFICUM).
Q41433 KUNITZ-TYPE PROTEINASE INHIBITOR - SOLANUM TUBEROSUM (POTATO).
Q41448 CATHEPSIN D INHIBITOR PROTEIN - SOLANUM TUBEROSUM (POTATO).
Q41480 PROTEINASE INHIBITOR - SOLANUM TUBEROSUM (POTATO).
Q41481 PROTEINASE INHIBITOR - SOLANUM TUBEROSUM (POTATO).
Q41482 PROTEINASE INHIBITOR - SOLANUM TUBEROSUM (POTATO).
Q41483 PROTEINASE INHIBITOR - SOLANUM TUBEROSUM (POTATO).
Q41484 PROTEINASE INHIBITOR - SOLANUM TUBEROSUM (POTATO).
Q43646 CATHEPSIN D INHIBITOR - SOLANUM TUBEROSUM (POTATO).
Q43708 PUTATIVE KUNITZ CHYMOTRYPSIN INHIBITOR - PSOPHOCARPUS TETRAGONOLOBUS (GOA BEAN) (ASPARAGUS BEAN).
Q43721 PUTATIVE KUNITZ CHYMOTRYPSIN INHIBITOR-X - PSOPHOCARPUS TETRAGONOLOBUS (GOA BEAN) (ASPARAGUS BEAN).
SPR1_IPOBA SPORAMIN A PRECURSOR (CLONE PIM0335) - IPOMOEA BATATAS (SWEET POTATO) (BATATE).
SPR2_IPOBA SPORAMIN B PRECURSOR (CLONE PIM0535) - IPOMOEA BATATAS (SWEET POTATO) (BATATE).
SPRA_IPOBA SPORAMIN A PRECURSOR - IPOMOEA BATATAS (SWEET POTATO) (BATATE).
SPRB_IPOBA SPORAMIN B PRECURSOR - IPOMOEA BATATAS (SWEET POTATO) (BATATE).

ITRY_ACACO TRYPSIN INHIBITOR PRECURSOR - ACACIA CONFUSA.
LSPI_CARPA LATEX SERINE PROTEINASE INHIBITOR - CARICA PAPAYA (PAPAYA).
Q39091 DR4 MRNA - ARABIDOPSIS THALIANA (MOUSE-EAR CRESS).

ALB1_PSOTE ALBUMIN-1 (WBA-1) - PSOPHOCARPUS TETRAGONOLOBUS (GOA BEAN) (ASPARAGUS BEAN).
IAAS_ORYSA ALPHA-AMYLASE/SUBTILISIN INHIBITOR (RASI) - ORYZA SATIVA (RICE).
ID5A_ADEPA TRYPSIN INHIBITOR DE5, ALPHA CHAIN - ADENANTHERA PAVONINA (SANDAL BEAD TREE) (CONDORI WOOD).
ID5A_PROJU KUNITZ-TYPE TRYPSIN INHIBITOR ALPHA CHAIN - PROSOPSIS JULIFLORA (MESQUITE) (ALGORROBO).
ITC_ALOMA TRYPSIN/CHYMOTRYPSIN INHIBITOR - ALOCASIA MACRORRHIZA (GIANT TARO).
Q40129 HYPOTHETICAL 25.2 KD PROTEIN PRECURSOR - LYCOPERSICON ESCULENTUM (TOMATO).
Q41505 TRYPSIN INHIBITOR - SALIX VIMINALIS (OSIER).
Q42436 PUTATIVE DROUGHT INDUCED PROTEIN - BRASSICA RAPA (TURNIP).
Q96230 TRYPSIN/CHYMOTRYPSIN INHIBITOR PRECURSOR - ALOCASIA MACRORRHIZA (GIANT TARO).
Scan History
OWL17_1    3  100  NSINGLE    
OWL18_0 1 100 NSINGLE
OWL19_1 1 100 NSINGLE
OWL26_0 2 300 NSINGLE
SPTR37_9f 4 100 NSINGLE
Initial Motifs
Motif 1  width=30
Element Seqn Id St Int Rpt
PVLDTNGKELNPDSSYRIISIGRGALGGDV IAP_SOLTU 39 39 -
PLLDSEGELVRNGGTYYLLPDRWALGGGIE IT1A_PSOTE 2 2 -
PVLDINGDEVRAGENYYMVSAIWGAGGGGL SPR2_IPOBA 40 40 -
PVHDTDGNELRADANYYVLPANRAHGGGLT IAAS_WHEAT 4 4 -

Motif 2 width=21
Element Seqn Id St Int Rpt
CPDGVFRYNSDVGPSGTPVRF IAP_SOLTU 80 11 -
CPLTVVRSPNEVSVGEPLRIS IT1A_PSOTE 40 8 -
CASDVIVSRSDFDNGDPITIT SPR2_IPOBA 81 11 -
CPLFVSQEADGQRDGLPVRIA IAAS_WHEAT 42 8 -

Motif 3 width=20
Element Seqn Id St Int Rpt
YFKIVKLSNFGYNLLYCPIT IAP_SOLTU 158 57 -
LFKFEKVTSKFSSYKLKYCA IT1A_PSOTE 115 54 -
QFKIEVVNDNLNAYKISYCQ SPR2_IPOBA 159 57 -
AFRIEKYSGAEVHEYKLMAC IAAS_WHEAT 124 61 -

Motif 4 width=30
Element Seqn Id St Int Rpt
DNFCAKVGVVIQNGKRRLALVNENPLDVLF IAP_SOLTU 188 10 -
DTCKDIGIYRDQKGYERLVVTDENPLVVIF IT1A_PSOTE 137 2 -
KCFNVGRYYDPLTRATRLALSNIPFVFVIK SPR2_IPOBA 183 4 -
SCQDLGVFRDLKGGAWFLGATEPYHVVVFK IAAS_WHEAT 146 2 -
Final Motifs
Motif 1  width=30
Element Seqn Id St Int Rpt
PVLDTNGKKLNPNSSYRIISTFWGALGGDV Q41483 39 39 -
PVLDTNGKELNPNSSYRIISIGRGALGGDV ICTD_SOLTU 7 7 -
PVLDTNGKELNPDSSYRIISIGRGALGGDV IAP_SOLTU 39 39 -
PVLDTDGKKLNPNSSYRIISTFWGALGGDV Q41480 39 39 -
PVLDTNGKELNPNSSYRIISIGRGALGGDV Q43646 39 39 -
PVLDTNGKELNPNSSYRIISIGRGALGGDV ICTC_SOLTU 39 39 -
PVLDINGDEVRAGGNYYMVSAIWGAGGGGL Q40084 42 42 -
RVLDTNGKKLNPNSSYRIISTFWGALGGDV Q41448 39 39 -
PVLDINGDEVRAGGNYYMVSAIWGAGGGGL Q40092 42 42 -
PVLDINGDEVRAGGNYYMVSAIWGAGGGGL Q40085 42 42 -
PVLDINGDEVRAGGNYYMVSAIWGAGGGGL SPR1_IPOBA 42 42 -
PVLDINGDEVRAGGNYYMVSAIWGAGGGGL Q40083 42 42 -
VLLDGNGEVVQNGGTYYLLPQVWAQGGGVQ IDE3_ERYVA 1 1 -
PLLDSEGELVRNGGTYYLLPDRWALGGGIE IT1A_PSOTE 2 2 -
PLLDSEGELVRNGGTYYLLPDRWALGGGIE IT1B_PSOTE 2 2 -
VLLDGNGEVVQNGGTYYLLPQVWAQGGGVQ IDE3_ERYLA 1 1 -
PVLDVTGKELDPRLSYRIISIGRGALGGDV Q41484 35 35 -
PVLDVAGKELDSRLSYRIISTFWGALGGDV Q41482 35 35 -
PVLDVAGKELDSRLSYRIISTFWGALGGDV Q41481 35 35 -
PVLDVAGKELDSRLSYRIISTFWGALGGDV IAP2_SOLTU 35 35 -
PVLDINGDEVRAGENYYIVSAIWGAGGGGL SPRB_IPOBA 40 40 -
PVLDINGDEVRAGENYYIVSAIWGAGGGGL Q40091 40 40 -
VLLDGNGEVVQNGGTYYLLPQVWAQGGGVQ IDE3_ERYCA 1 1 -
PVLDINGDEVRAGENYYMVSAIWGAGGGGL SPR2_IPOBA 40 40 -
PVLDTNGNELNPNSSYRIISTFWGALGGDV Q08332 39 39 -
PVLDVTGKELDPRLSYHIISTFWGALGGDV Q41433 35 35 -
FVLDNEGNPLSNGGTYYILSDITAFGGIRA ITRB_SOYBN 2 2 -
DLVDAEGNLVENGGTYYLLPHIWAHGGGIE Q43708 27 27 -
DLVDAEGNLVENGGTYYLLPHIWAHGGGIE ICW3_PSOTE 27 27 -
FVLDNEGNPLDSGGTYYILSDITAFGGIRA Q39899 27 27 -
FVLDTDDDPLQNGGTYYMLPVMRGKGGGIE KTI1_SOYBN 27 27 -
ELVDVEGEDVVNGGTYYMLPGIEGDGGGME IT1B_ERYVA 1 1 -
DLVDVEGNLVENGGTYYLLPQITAHGGGIE Q43721 27 27 -
PVLDINGDEVRAGGNYYMVYAILGACGGGL SPRA_IPOBA 42 42 -
FVLDNEGNPLENGGTYYILSDITAFGGIRA Q39898 27 27 -
FVLDNEGNPLENGGTYYILSDITAFGGIRA ITRA_SOYBN 26 26 -
PLVDLEGNLVENGGTYYLLPHIWALGGGIE IECI_ERYVA 2 2 -
FVLDTDDDPLQNGGTYYMLPVMRGKSGGIE KTI2_SOYBN 27 27 -
PVLDTDGDELQTGVQYYVLSSISGAGGGGL ASP_THECC 30 30 -
ELVDVEGKTVRNGGTYYLVPQLRPGGGGME IT2_PSOTE 2 2 -
PVLDIDGEKLRTGTNYYIVPVLRDHGGGLT MIRA_RICDU 6 6 -
PVLDIDGEKLRTGTNYYIVPVLRDHGGGLT Q41153 35 35 -
EVVDIDGKILRTGVDYYILPVVRGRGGGLT O48625 30 30 -
QVLDVNGKPIFPGGQYYILPAIRGPPGGGV O82711 31 31 -
PVHDTDGHELRADANYYVLSANRAHGGGLT IAAS_HORVU 27 27 -
PVHDTDGHELRADANYYVLSANRAHGGGLT Q40023 28 28 -
AVVDIAGKKLRTGIDYYILPVVRGRGGGLT P93378 30 30 -
QVLDFNGNPIFPGVQYFILPAIRGPAGGGV Q41015 31 31 -
PVHDTDGNELRADANYYVLPANRAHGGGLT IAAS_WHEAT 4 4 -
IVFDTEGNPIRNGGTYYVLPVIRGKGGGIE Q39869 27 27 -
PVLDTDGDIIFDGSYYVLPLIWGPTGGGLT Q39369 23 23 -

Motif 2 width=21
Element Seqn Id St Int Rpt
CPDGVFRYNSDVGPSGTPVRF Q41483 80 11 -
CPDGVFRYNSDVGPSGTPVRF ICTD_SOLTU 48 11 -
CPDGVFRYNSDVGPSGTPVRF IAP_SOLTU 80 11 -
CPDGVFRYNSDVGPSGTPVRF Q41480 80 11 -
CPDGVFRYNSDVGPSGTFVRF Q43646 80 11 -
CPDGVFRYNSDVGPSGTPVRF ICTC_SOLTU 80 11 -
CASDVIVSPNDLDNGDPITIT Q40084 82 10 -
CPDGVFRYNSDVGPSGTPVRF Q41448 80 11 -
CASDVIVSPNDLDNGDPITIT Q40092 82 10 -
CASDVIVSPNDLDNGDPITIT Q40085 82 10 -
CATDVIVSPNDLDNGDPITIT SPR1_IPOBA 82 10 -
CASDVIVSPNDLDNGDPITIT Q40083 82 10 -
CPLTVVQSPNELSNGKPIRIE IDE3_ERYVA 39 8 -
CPLTVVRSPNEVSVGEPLRIS IT1A_PSOTE 40 8 -
CPLTVVRSPNEVSVGEPLRIS IT1B_PSOTE 40 8 -
CPLTVVQSPNELSDGKPIRIE IDE3_ERYLA 39 8 -
CANGVFRFNSDVGPSGTPVRF Q41484 76 11 -
CANGIFRYNSDVGPSGTPVRF Q41482 76 11 -
CANGIFRYNSDVGPSGTPVRF Q41481 76 11 -
CANGIFRYNSDVGPSGTPVRF IAP2_SOLTU 76 11 -
CASDVIVSRSDFDNGDPITIT SPRB_IPOBA 81 11 -
CASDVIVSRSDFDNGDPITIT Q40091 81 11 -
CPLTVVQSPNELSDGKPIRIE IDE3_ERYCA 39 8 -
CASDVIVSRSDFDNGDPITIT SPR2_IPOBA 81 11 -
CLDGVFRYNSDVGTVGTPVRF Q08332 80 11 -
CANGIFRYNSDVGPSGTPVRF Q41433 76 11 -
CPLTVVQSRNELDKGIGTIIS ITRB_SOYBN 39 7 -
CPLTVVRSPNEVSKGEPIRIS Q43708 65 8 -
CPLTVVRSPNEVSKGEPIRIS ICW3_PSOTE 65 8 -
CPLTVVQSRNELDKGIGTIIS Q39899 64 7 -
CPLTVVQSPNELDKGIGLVFT KTI1_SOYBN 65 8 -
CPITVVQSRNDVSNGEPITIE IT1B_ERYVA 39 8 -
CPLTVVQSPYEVSNGEPIRIS Q43721 65 8 -
CASDVIVSPNDLDNGDLITIT SPRA_IPOBA 82 10 -
CPLTVVQSRNELDKGIGTIIS Q39898 64 7 -
CPLTVVQSRNELDKGIGTIIS ITRA_SOYBN 63 7 -
CPLTVVQSPFEVSNGEPIRIA IECI_ERYVA 40 8 -
CPLTVVQSPNKHNKGIGLVFK KTI2_SOYBN 65 8 -
CPEIVVQRRSDLDNGTPVIFS ASP_THECC 69 9 -
CPLTVVKSLDENSNGEPIRIA IT2_PSOTE 40 8 -
CPPRVVQTRKEVDHDRPLAFF MIRA_RICDU 47 11 -
CPPRVVQTRKEVDHDRPLAFF Q41153 76 11 -
PLDAVVQEHNEIDQGLPLTFT O48625 69 9 -
CPVTVLQDRREVKNGLPVKFV O82711 70 9 -
CPLFVSQDPNGQHDGFPVRIT IAAS_HORVU 65 8 -
CPLFVSQDPNGQHDGFPVRIT Q40023 66 8 -
PLDAVVQEQQEIKNGLPLTFT P93378 69 9 -
CPVTVLQDRQEVKNGLPVKFV Q41015 70 9 -
CPLFVSQEADGQRDGLPVRIA IAAS_WHEAT 42 8 -
CPLTVVQSPFEGLQRGLPLII Q39869 65 8 -
CPLFIGQERSEVNRGIPVKFS Q39369 61 8 -

Motif 3 width=20
Element Seqn Id St Int Rpt
YFKIVKSSKFGYNLLYCPIT Q41483 158 57 -
YFKIVKLSNFGYNLLYCPIT ICTD_SOLTU 126 57 -
YFKIVKLSNFGYNLLYCPIT IAP_SOLTU 158 57 -
YFKIVKSSKFGYNLLYCPIT Q41480 158 57 -
YFKIVKLSNFGYNLLYCPIT Q43646 158 57 -
YFKIVKSSILGYNLLYCPIT ICTC_SOLTU 157 56 -
QFKIELVDANLNSYKLTYCQ Q40084 162 59 -
YFKIVKSSKFGYNLLYCPLT Q41448 159 58 -
QFKIEVVDANLNFYKLTYCQ Q40092 162 59 -
QFKIEVVDANLNFYKLTYCQ Q40085 162 59 -
QFKIELVDANLNSYKLTYCQ SPR1_IPOBA 162 59 -
QFKIEVVDANLNFYKLTYCQ Q40083 162 59 -
PFKFEQVSDKLHSYKLLYCE IDE3_ERYVA 114 54 -
LFKFEKVTSKFSSYKLKYCA IT1A_PSOTE 115 54 -
LFKFEKVTSKFSSYKLKYCA IT1B_PSOTE 115 54 -
PFKFEQVSDKLHSYKLLYCE IDE3_ERYLA 114 54 -
WFKIVKSSQLGYNLLYCPFS Q41484 158 61 -
WFKIVKSSQFGYNLLYCPVT Q41482 158 61 -
WFKIVKSSQFGYNLLYCPVT Q41481 158 61 -
WFKIVKSSQFGYNLLYCPVT IAP2_SOLTU 154 57 -
QFKIEVVNDNLNAYKISYCQ SPRB_IPOBA 159 57 -
QFKIEVVNDNLNAYKISYCQ Q40091 159 57 -
PFKFEQVSDQLHSYKLLYCE IDE3_ERYCA 114 54 -
QFKIEVVNDNLNAYKISYCQ SPR2_IPOBA 159 57 -
YFKIVKASTFGYNLLYCPIT Q08332 158 57 -
WFKIVQSSQFGYNLLYCPVT Q41433 158 61 -
WFRIERVSDDEFNNYKLVFC ITRB_SOYBN 117 57 -
VFKFEKVSHSNIHVYKLLYC Q43708 140 54 -
VFKFEKVSHSNIHVYKLLYC ICW3_PSOTE 140 54 -
WFRIERVSDDEFNNYKLVFC Q39899 142 57 -
WFNIERVSREYNDYKLVFCP KTI1_SOYBN 141 55 -
SFKFEDVSSKLHSYKLSYCV IT1B_ERYVA 114 54 -
VFKFEKVSHSNIHVYKLLYC Q43721 140 54 -
QFKIEVVDANLNFYKLTYCL SPRA_IPOBA 162 59 -
WFRLERVSDDEFNNYKLVFC Q39898 142 57 -
WFRLERVSDDEFNNYKLVFC ITRA_SOYBN 141 57 -
KFKFQKVSSPNRYVYNLSYC IECI_ERYVA 115 54 -
WFNIERVSREYNDYYKLVFC KTI2_SOYBN 141 55 -
WFKIEKAGVLGYKFRFCPSV ASP_THECC 153 63 -
KFERVYAASKMYAYKLLYCG IT2_PSOTE 118 57 -
WFKIEEFCGSGFYKLVFCPT MIRA_RICDU 131 63 -
WFKIEEFCGSGFYKLVFCPT Q41153 160 63 -
WFKIEKYDRDYKLLYCPTVC O48625 151 61 -
LFKIEKHESGFGYKLGFCIK O82711 151 60 -
AFRIEKYSGAEVHEYKLMSC IAAS_HORVU 147 61 -
AFRIEKYSGAEVHEYKLMSC Q40023 148 61 -
WFKIEKFERDYKLVYCPTVC P93378 151 61 -
LFKIEKHESGFGYKLGFCVK Q41015 151 60 -
AFRIEKYSGAEVHEYKLMAC IAAS_WHEAT 124 61 -
WFRIQRASSESNYYKLVFCT Q39869 142 56 -
FFQIKKTEAKLNAYKFVFCS Q39369 144 62 -

Motif 4 width=30
Element Seqn Id St Int Rpt
DDFCAKVGVVIQNGKRRLALVNENPLDVLF Q41483 189 11 -
DNFCAKVGVVIQNGKRRLALVNENPLDVLF ICTD_SOLTU 156 10 -
DNFCAKVGVVIQNGKRRLALVNENPLDVLF IAP_SOLTU 188 10 -
DDFCAKVGVVIQNGKRRLALVNENPLDVLF Q41480 189 11 -
DNFCAKVGVVIQNGKRRLALVNENPLDVLF Q43646 188 10 -
DDFCAKVGVVIQKGKRRLALVNENPLDVNF ICTC_SOLTU 187 10 -
KCYNVGRFHDHMLRTTRLALSNSPFVFVIK Q40084 186 4 -
DNFCAKVGVVIQNGKRRLALVNENPLDVLF Q41448 189 10 -
KCYNVGRFHDPMLRTTRLALSNSPFVFVIK Q40092 186 4 -
KCYNVGRFHDPMLRTTRLALSNSPFVFVIK Q40085 186 4 -
KCYNVGRFHDHMLRTTRLALSNSPFVFVIK SPR1_IPOBA 186 4 -
KCYNCGRFHDPMLRTTRLALSNSPFVFVIK Q40083 186 4 -
EKCASIGINRDQKGYRRLVVTEDNPLTVVL IDE3_ERYVA 137 3 -
DTCKDIGIYRDQKGYERLVVTDENPLVVIF IT1A_PSOTE 137 2 -
DTCKDIGIYRDQKGYARLVVTDENPLVVIF IT1B_PSOTE 137 2 -
EKCASIGINRDQKGYRRLVVTEDNPLTVVL IDE3_ERYLA 137 3 -
DQFCLKVGVVHQNGKRRLALVKDNPLDVSF Q41484 180 2 -
DQFCLKVGVVHQNGKRRLALVKDNPLDVSF Q41482 188 10 -
DQFCLKVGVVHQNGKRRLALVKDNPLDVSF Q41481 188 10 -
DQFCLKVGVVHQNGKRRLALVKDNPLDVSF IAP2_SOLTU 184 10 -
KCFNVGRYYDPLTRATRLALSNTPFVFVIK SPRB_IPOBA 183 4 -
KCFNVGRYYDPLTRATRLALSNTPFVFVIK Q40091 183 4 -
EKCASIGINRDQKGYRRLVVTEDYPLTVVL IDE3_ERYCA 137 3 -
KCFNVGRYYDPLTRATRLALSNIPFVFVIK SPR2_IPOBA 183 4 -
DGFCAKVGVINQDGRRRLALVNENPLGVYF Q08332 188 10 -
DQFCLKVGVVHQNGKRRLALVKDNPLDVSF Q41433 188 10 -
KCGDIGISIDHDDGTRRLVVSKNKPLVVQF ITRB_SOYBN 144 7 -
KCDQYIGIHRDRNGNRRLVVTEENPLELVL Q43708 167 7 -
KCDQYIGIHRDRNGNRRLVVTEENPLELVL ICW3_PSOTE 167 7 -
KCGDIGISIDHDDGTRRLVVSKNKPLVVQF Q39899 169 7 -
NKCEDIGIQIDDDGIRRLVLSKNKPLVVQF KTI1_SOYBN 166 5 -
YICKNIGIYRDSKGYRRLVVNEENPLVVVL IT1B_ERYVA 141 7 -
KCDQYIGIHRDRNGNRRLVVTKKNPLELVL Q43721 167 7 -
KCYNVGRFKDPMLRTTRLALSYYPFFFVIK SPRA_IPOBA 186 4 -
KCGDIGISIDHDDGTRRLVVSKNKPLVVQF Q39898 169 7 -
KCGDIGISIDHDDGTRRLVVSKNKPLVVQF ITRA_SOYBN 168 7 -
KCDQYIGIRRDAKGYRRLVVTNDNPLELVL IECI_ERYVA 142 7 -
NKCEDIGIQIDNDGIRRLVLSKNKPLVVEF KTI2_SOYBN 167 6 -
TLCSDIGRHSDDDGQIRLALSDNEWAWMFK ASP_THECC 178 5 -
MMCKDIGVYRDQEGYQRLVVSKHNPLVVGF IT2_PSOTE 145 7 -
VKCGDVGIYIDQKGRRRLALSDKPFAFEFN MIRA_RICDU 157 6 -
VKCGDVGIYIDQKGRRRLALSDKPFAFEFN Q41153 186 6 -
KVICRDIGIFIQDGVRRLALSDVPFKVMFK O48625 174 3 -
PTCLDVGRFDNDEAGRRLNLTEHESFQVVF O82711 173 2 -
WCQDLGVFRDLKGGAWFLGATEPYHVVVFK IAAS_HORVU 169 2 -
WCQDLGVFRDLKGGAWFLGATEPYHVVVFK Q40023 170 2 -
KVICKDVGIFIQDGIRRLALSDVPFKVMFK P93378 174 3 -
PTCLDVGRFDNDEDGRRLNLTEHESFQVVF Q41015 173 2 -
SCQDLGVFRDLKGGAWFLGATEPYHVVVFK IAAS_WHEAT 146 2 -
SSCGDIVAPIDREGNRPLIVTHDQNHPLLV Q39869 166 4 -
GNDCIDVGKNEEGGVRGLVLGSTPPFATPF Q39369 165 1 -