SPRINT Home UMBER Home Contents Standard Search Advanced Search Relation Search

==SPRINT==> PRINTS View



  selected as


PR00214

Identifier
MYELINPLP  [View Relations]  [View Alignment]  
Accession
PR00214
No. of Motifs
7
Creation Date
11-JUL-1994  (UPDATE 07-JUN-1999)
Title
Myelin proteolipid protein (PLP) signature
Database References

PROSITE; PS00575 MYELIN_PLP_1; PS01004 MYELIN_PLP_2
BLOCKS; BL00575
PFAM; PF01275 Myelin_PLP
INTERPRO; IPR001614
Literature References
1. SAKAMOTO, Y., KITAMURA, K., YOSHIMURA, K., NISHIJIMA, T. AND UYEMURA, K.
Complete amino acid sequence of P0 protein in bovine peripheral nerve
myelin.
J.BIOL.CHEM. 262 4208-4214 (1987).
 
2. SHAW, S.Y., LAURSEN, R.A. AND LEES, M.B.
Identification of thiol groups and a disulfide crosslink site in bovine
myelin proteolipid protein.
FEBS LETT. 250 306-310 (1989).
 
3. DIEHL, H.J., SCHAICH, M., BUDZINSKI, R.M. AND STOFFEL, W.
Individual exons encode the integral membrane domains of human myelin 
proteolipid protein.
PROC.NATL.ACAD.SCI.U.S.A. 83 9807-9811 (1986).

Documentation
The myelin sheath is a multi-layered membrane, unique to the nervous system,
that functions as an insulator to greatly increase the velocity of axonal
impulse conduction [1]. Myelin proteolipid protein (PLP) is the major
protein found in the sheath of central nervous system nerves [2]. It spans
the membrane 4 times [3] and is thought to play a role in the formation or
maintenance of the multi-lamellar structure. The protein contains several
cysteine residues, some involved in the formation of disulphide bonds,
others being palmitoylated [2]. Mutations in PLP result in neurological
disorders, such as Pelizaeus-Merzbacher disease in humans, `jimpy' in
mice, and `shaking pup' in dogs.
 
MYELINPLP is a 7-element fingerprint that provides a signature for myelin 
proteolipid proteins. The fingerprint was derived from an initial alignment
of 4 sequences: motifs 1, 2, 5 and 7 encode the 4 transmembrane (TM)
domains - motif 4 includes the region encoded by PROSITE pattern MYELIN_
PLP_1 (PS00575), which is located between the second and third TM segments
and contains 2 Cys residues that are palmitoylated; motif 7 includes part
of the region encoded by PROSITE pattern MYELIN_PLP_2 (PS01004). Two
iterations on OWL23.2 were required to reach convergence, at which point a
true set comprising 9 sequences was identified. Several partial matches
were also found, all of which are either deletion mutants or myelin PLP
fragments.
 
An update on SPTR37_9f identified a true set of 8 sequences, and 9
partial matches.
Summary Information
   8 codes involving  7 elements
1 codes involving 6 elements
5 codes involving 5 elements
0 codes involving 4 elements
3 codes involving 3 elements
0 codes involving 2 elements
Composite Feature Index
78888888
61111110
55520355
40000000
33330000
20000000
1234567
True Positives
MYP1_XENLA    MYP2_XENLA    MYPR_BOVIN    MYPR_CANFA    
MYPR_CHICK MYPR_HUMAN MYPR_POEGU MYPR_RABIT
True Positive Partials
Codes involving 6 elements
Q62079
Codes involving 5 elements
DMA_SQUAC DMG_SQUAC M6B_MOUSE MYPR_ONCMY
O76077
Codes involving 3 elements
DMB_SQUAC M6A_HUMAN M6A_MOUSE
Sequence Titles
MYP1_XENLA  MYELIN PROTEOLIPID PROTEIN 1 (PLP) (LIPOPHILIN) - XENOPUS LAEVIS (AFRICAN CLAWED FROG). 
MYP2_XENLA MYELIN PROTEOLIPID PROTEIN 2 (PLP) (LIPOPHILIN) - XENOPUS LAEVIS (AFRICAN CLAWED FROG).
MYPR_BOVIN MYELIN PROTEOLIPID PROTEIN (PLP) (LIPOPHILIN) [CONTAINS: MYELIN PROTEIN DM-20] - BOS TAURUS (BOVINE).
MYPR_CANFA MYELIN PROTEOLIPID PROTEIN (PLP) (LIPOPHILIN) - CANIS FAMILIARIS (DOG).
MYPR_CHICK MYELIN PROTEOLIPID PROTEIN (PLP) (LIPOPHILIN) - GALLUS GALLUS (CHICKEN).
MYPR_HUMAN MYELIN PROTEOLIPID PROTEIN (PLP) (LIPOPHILIN) [CONTAINS: MYELIN PROTEIN DM-20] - HOMO SAPIENS (HUMAN), RATTUS NORVEGICUS (RAT), AND MUS MUSCULUS (MOUSE).
MYPR_POEGU MYELIN PROTEOLIPID PROTEIN (PLP) (LIPOPHILIN) - POEPHILA GUTTATA (ZEBRA FINCH) (TAENIOPYGIA GUTTATA).
MYPR_RABIT MYELIN PROTEOLIPID PROTEIN (PLP) (LIPOPHILIN) - ORYCTOLAGUS CUNICULUS (RABBIT).

Q62079 MYELIN PROTEOLIPID - MUS MUSCULUS (MOUSE).

DMA_SQUAC PROTEOLIPID PROTEIN DM ALPHA - SQUALUS ACANTHIAS (SPINY DOGFISH).
DMG_SQUAC PROTEOLIPID PROTEIN DM GAMMA - SQUALUS ACANTHIAS (SPINY DOGFISH).
M6B_MOUSE MEMBRANE GLYCOPROTEIN M6-B - MUS MUSCULUS (MOUSE).
MYPR_ONCMY MYELIN PROTEOLIPID PROTEIN (PLP) (LIPOPHILIN) (DM20) - ONCORHYNCHUS MYKISS (RAINBOW TROUT) (SALMO GAIRDNERI).
O76077 M6B1 PROTEIN - HOMO SAPIENS (HUMAN).

DMB_SQUAC PROTEOLIPID PROTEIN DM BETA - SQUALUS ACANTHIAS (SPINY DOGFISH).
M6A_HUMAN MEMBRANE GLYCOPROTEIN M6-A - HOMO SAPIENS (HUMAN).
M6A_MOUSE MEMBRANE GLYCOPROTEIN M6-A - MUS MUSCULUS (MOUSE).
Scan History
OWL23_2    2  100  NSINGLE    
OWL28_0 1 100 NSINGLE
SPTR37_9f 2 97 NSINGLE
Initial Motifs
Motif 1  width=30
Element Seqn Id St Int Rpt
CCARCLVGAPFASLVATGLCFFGVALFCGC MYPR_BOVIN 5 5 -
CCARCLVGAPFASLVATGLCFFGVALFCGC MYPR_CANFA 5 5 -
CCARCLVGAPFASLVATGLCFFGVALFCGC MYPR_HUMAN 5 5 -
CCARCLIGAPFASLVATGLCFFGVALFCGC MYPR_CHICK 5 5 -

Motif 2 width=29
Element Seqn Id St Int Rpt
YLINVIHAFQYVIYGTASFFFLYGALLLA MYPR_BOVIN 59 23 -
YLINVIHAFQYVIYGTASFFFLYGALLLA MYPR_CANFA 59 23 -
YLINVIHAFQYVIYGTASFFFLYGALLLA MYPR_HUMAN 59 23 -
YLIDVIHAFQYVIYGTASFFFLYGALLLA MYPR_CHICK 59 23 -

Motif 3 width=30
Element Seqn Id St Int Rpt
GFYTTGAVRQIFGDYKTTICGKGLSATVTG MYPR_BOVIN 89 1 -
GFYTTGAVRQIFGDYKTTICGKGLSATVTG MYPR_CANFA 89 1 -
GFYTTGAVRQIFGDYKTTICGKGLSATVTG MYPR_HUMAN 89 1 -
GFYTTGAVRQIFGDYRTTICGKGLSATVTG MYPR_CHICK 89 1 -

Motif 4 width=30
Element Seqn Id St Int Rpt
KGRGSRGQHQAHSLERVCHCLGKWLGHPDK MYPR_BOVIN 121 2 -
KGRGSRGQHQAHSLERVCHCLGKWLGHPDK MYPR_CANFA 121 2 -
KGRGSRGQHQAHSLERVCHCLGKWLGHPDK MYPR_HUMAN 121 2 -
KGRGARGPQRAHSLQRVCQCLGKWLGHPDK MYPR_CHICK 121 2 -

Motif 5 width=27
Element Seqn Id St Int Rpt
FVGITYALTVVWLLVFACSAVPVYIYF MYPR_BOVIN 151 0 -
FVGITYALTIVWLLVFACSAVPVYIYF MYPR_CANFA 151 0 -
FVGITYALTVVWLLVFACSAVPVYIYF MYPR_HUMAN 151 0 -
FVGITYVLTIVWLLAFACSAVPVYIYF MYPR_CHICK 151 0 -

Motif 6 width=29
Element Seqn Id St Int Rpt
KTSASIGTLCADARMYGVLPWNAFPGKVC MYPR_BOVIN 191 13 -
KTSASIGSLCADARMYGVLPWNAFPGKVC MYPR_CANFA 191 13 -
KTSASIGSLCADARMYGVLPWNAFPGKVC MYPR_HUMAN 191 13 -
KTTASIGTLCADARMYGVLPWNAFPGKVC MYPR_CHICK 191 13 -

Motif 7 width=30
Element Seqn Id St Int Rpt
LFIAAFVGAAATLVSLLTFMIAATYNFAVL MYPR_BOVIN 238 18 -
LFIAAFVGAAATLVSLLTFMIAATYNFAVL MYPR_CANFA 238 18 -
LFIAAFVGAAATLVSLLTFMIAATYNFAVL MYPR_HUMAN 238 18 -
LFIAAFVGAAATLVSLLTFMIAATYNFAVL MYPR_CHICK 238 18 -
Final Motifs
Motif 1  width=30
Element Seqn Id St Int Rpt
CCARCLVGAPFASLVATGLCFFGVALFCGC MYPR_BOVIN 5 5 -
CCARCLVGAPFASLVATGLCFFGVALFCGC MYPR_RABIT 5 5 -
CCARCLVGAPFASLVATGLCFFGVALFCGC MYPR_CANFA 5 5 -
CCARCLVGAPFASLVATGLCFFGVALFCGC MYPR_HUMAN 5 5 -
CCARCLIGAPFASLVATGLCFFGVALFCGC MYPR_CHICK 5 5 -
CCARCLIGAPFASLVATGLCFFGVALFCGC MYPR_POEGU 5 5 -
GCIRCMVGVPFASVIATVLCFAGVALFCGC MYP2_XENLA 6 6 -
GCIRCMVGVPFASVIATVLCFAGVALFCGC MYP1_XENLA 6 6 -

Motif 2 width=29
Element Seqn Id St Int Rpt
YLINVIHAFQYVIYGTASFFFLYGALLLA MYPR_BOVIN 59 23 -
YLINVIHAFQYVIYGTASFFFLYGALLLA MYPR_RABIT 59 24 -
YLINVIHAFQYVIYGTASFFFLYGALLLA MYPR_CANFA 59 23 -
YLINVIHAFQYVIYGTASFFFLYGALLLA MYPR_HUMAN 59 23 -
YLIDVIHAFQYVIYGTASFFFLYGALLLA MYPR_CHICK 59 23 -
FLIDVIHGFQYFIYGTAAFFFLYGALLLA MYPR_POEGU 59 24 -
YLIHVINAFQFVIYGIAIFFFLYGILLLA MYP2_XENLA 60 24 -
YLIHVINAFQYVIYGIAIFFFLFGILLLA MYP1_XENLA 60 24 -

Motif 3 width=30
Element Seqn Id St Int Rpt
GFYTTGAVRQIFGDYKTTICGKGLSATVTG MYPR_BOVIN 89 1 -
GFYTTGAVRQIFGDYKTTICGKGLSATVTG MYPR_RABIT 89 1 -
GFYTTGAVRQIFGDYKTTICGKGLSATVTG MYPR_CANFA 89 1 -
GFYTTGAVRQIFGDYKTTICGKGLSATVTG MYPR_HUMAN 89 1 -
GFYTTGAVRQIFGDYRTTICGKGLSATVTG MYPR_CHICK 89 1 -
GFYTTGAVRQIFGDYRTTICGKGLSATVTG MYPR_POEGU 89 1 -
GFYTTTAIKHILGEFKPPAMKGGLISTVTG MYP2_XENLA 90 1 -
GFYTTTAIKHILGEFKPPAIKGGLISTVTG MYP1_XENLA 90 1 -

Motif 4 width=30
Element Seqn Id St Int Rpt
KGRGSRGQHQAHSLERVCHCLGKWLGHPDK MYPR_BOVIN 121 2 -
KGRGSRGQHQAHSLERVCHCLGKWLGHPDK MYPR_RABIT 121 2 -
KGRGSRGQHQAHSLERVCHCLGKWLGHPDK MYPR_CANFA 121 2 -
KGRGSRGQHQAHSLERVCHCLGKWLGHPDK MYPR_HUMAN 121 2 -
KGRGARGPQRAHSLQRVCQCLGKWLGHPDK MYPR_CHICK 121 2 -
KGRGARGPQRAHSWQRVCHCLGKWLGHPDK MYPR_POEGU 121 2 -
KGRSTRGRQPVHTIELICRCLGKWLGHPDK MYP2_XENLA 123 3 -
KGRSTRGRQPVHTIELICRCLGKWLGHPDK MYP1_XENLA 123 3 -

Motif 5 width=27
Element Seqn Id St Int Rpt
FVGITYALTVVWLLVFACSAVPVYIYF MYPR_BOVIN 151 0 -
FVGITYALTVVWLLVFACSAVPVYIYF MYPR_RABIT 151 0 -
FVGITYALTIVWLLVFACSAVPVYIYF MYPR_CANFA 151 0 -
FVGITYALTVVWLLVFACSAVPVYIYF MYPR_HUMAN 151 0 -
FVGITYVLTIVWLLAFACSAVPVYIYF MYPR_CHICK 151 0 -
FVGITYVLTIIWLLVFACSAVPVYIYF MYPR_POEGU 151 0 -
FVGVTYVITILWILIFACSAVPVYIYF MYP2_XENLA 153 0 -
FVGVTYIITILWILIFACSAVPVYIYF MYP1_XENLA 153 0 -

Motif 6 width=29
Element Seqn Id St Int Rpt
KTSASIGTLCADARMYGVLPWNAFPGKVC MYPR_BOVIN 191 13 -
KTSASIGTLCADARMYGVLPWNAFPGKVC MYPR_RABIT 191 13 -
KTSASIGSLCADARMYGVLPWNAFPGKVC MYPR_CANFA 191 13 -
KTSASIGSLCADARMYGVLPWNAFPGKVC MYPR_HUMAN 191 13 -
KTTASIGTLCADARMYGVLPWNAFPGKVC MYPR_CHICK 191 13 -
KTSASIGTLCADARMYGILPWNAFPGKVC MYPR_POEGU 191 13 -
KTTTSVSTLCLDARMYGVLPWNAFPGKVC MYP2_XENLA 193 13 -
KTTTSVSTLCSDRRMYGVLPWNAFPGKVC MYP1_XENLA 193 13 -

Motif 7 width=30
Element Seqn Id St Int Rpt
LFIAAFVGAAATLVSLLTFMIAATYNFAVL MYPR_BOVIN 238 18 -
LFIAAFVGAAATLVSLLTFMIAATYNFAVL MYPR_RABIT 238 18 -
LFIAAFVGAAATLVSLLTFMIAATYNFAVL MYPR_CANFA 238 18 -
LFIAAFVGAAATLVSLLTFMIAATYNFAVL MYPR_HUMAN 238 18 -
LFIAAFVGAAATLVSLLTFMIAATYNFAVL MYPR_CHICK 238 18 -
LFIAAFVGAAATLVSLVTFIIATTYNFAVL MYPR_POEGU 238 18 -
LFIAAFVGAAATLVALLTYMVGASFNYAVL MYP2_XENLA 240 18 -
LFIAAFVGAAATLVALLTYMVGASFNYAVL MYP1_XENLA 240 18 -