SPRINT Home UMBER Home Contents Standard Search Advanced Search Relation Search

==SPRINT==> PRINTS View



  selected as


PR00213

Identifier
MYELINP0  [View Relations]  [View Alignment]  
Accession
PR00213
No. of Motifs
6
Creation Date
11-JUL-1994  (UPDATE 07-JUN-1999)
Title
Myelin P0 protein signature
Database References

PROSITE; PS00568 MYELIN_P0
BLOCKS; BL00568
INTERPRO; IPR000920
Literature References
1. SAKAMOTO, Y., KITAMURA, K., YOSHIMURA, K., NISHIJIMA, T. AND UYEMURA, K.
Complete amino acid sequence of P0 protein in bovine peripheral nerve
myelin.
J.BIOL.CHEM. 262 4208-4214 (1987).
 
2. LEMKE, G. AND AXEL, R.
Isolation and sequence of a cDNA encoding the major structural protein of
peripheral myelin.
CELL 40(3) 501-508 (1985).

Documentation
The myelin sheath is a multi-layered membrane, unique to the nervous system,
that functions as an insulator to greatly increase the velocity of axonal
impulse conduction [1]. The P0 glycoprotein, absent in the central nervous
system [1], is a major component of the myelin sheath in peripheral nerves:
it comprises a large extracellular N-terminal domain, a single trans-
membrane (TM) region, and a smaller positively-charged intracellular
domain. It is postulated that P0 is a structural element in the formation
and stabilisation of peripheral nerve myelin [2], holding its characteristic
coil structure together by the interaction of its positively-charged domain
with acidic lipids in the cytoplasmic face of the opposed bilayer, and by
interaction between hydrophobic globular `heads' of adjacent extracellular
domains [1].
 
MYELINP0 is a 6-element fingerprint that provides a signature for the P0
family of myelin proteins. The fingerprint was derived from an initial 
alignment of 5 sequences: motifs 1-4 were drawn from conserved regions
spanning most of the extracellular domain; motif 5 encodes the TM region;
and motif 6 includes the region encoded by PROSITE pattern MYELIN_P0
(PS00565), which lies in the intracellular domain. Two iterations on OWL23.2
were required to reach convergence, at which point a true set comprising 6
sequences was identified. A single partial match was also found, HSMYELIN,
which matches all but the last motif as a result of an insertion mutation
in the gene.
 
An update on SPTR37_9f identified a true set of 6 sequences, and 4
partial matches.
Summary Information
   6 codes involving  6 elements
2 codes involving 5 elements
0 codes involving 4 elements
2 codes involving 3 elements
0 codes involving 2 elements
Composite Feature Index
6666666
5222220
4000000
3202200
2000000
123456
True Positives
MYP0_BOVIN    MYP0_CHICK    MYP0_HETFR    MYP0_HUMAN    
MYP0_MOUSE MYP0_RAT
True Positive Partials
Codes involving 5 elements
Q14902 Q91406
Codes involving 3 elements
O60487 O70255
Sequence Titles
MYP0_BOVIN  MYELIN P0 PROTEIN - BOS TAURUS (BOVINE).      
MYP0_CHICK MYELIN P0 PROTEIN PRECURSOR - GALLUS GALLUS (CHICKEN).
MYP0_HETFR MYELIN P0 PROTEIN PRECURSOR - HETERODONTUS FRANCISCI (HORN SHARK).
MYP0_HUMAN MYELIN P0 PROTEIN PRECURSOR - HOMO SAPIENS (HUMAN).
MYP0_MOUSE MYELIN P0 PROTEIN PRECURSOR - MUS MUSCULUS (MOUSE).
MYP0_RAT MYELIN P0 PROTEIN PRECURSOR - RATTUS NORVEGICUS (RAT).

Q14902 MYELIN PROTEIN ZERO - HOMO SAPIENS (HUMAN).
Q91406 IP1=CNS MYELIN P0-LIKE GLYCOPROTEIN - SALMO SP. (TROUT).

O60487 EPITHELIAL V-LIKE ANTIGEN PRECURSOR - HOMO SAPIENS (HUMAN).
O70255 EPITHELIAL V-LIKE ANTIGEN PRECURSOR - MUS MUSCULUS (MOUSE).
Scan History
OWL23_2    2  100  NSINGLE    
OWL28_0 1 100 NSINGLE
SPTR37_9f 2 51 NSINGLE
Initial Motifs
Motif 1  width=25
Element Seqn Id St Int Rpt
VGSQVTLHCSFWSSEWVSDDISFTW MYP0_RAT 42 42 -
VGSQVTLHCSFWSSEWVSDDISFTW MYP0_MOUSE 42 42 -
VGSQVTLYCSFWSSEWVSDDLSFTW MYP0_BOVIN 13 13 -
VGSRVTLHCSFWSSEWVSDDISFTW MYP0_HUMAN 42 42 -
VGSDVTLYCGFWSNEYVSDLTTLSW MYP0_HETFR 40 40 -

Motif 2 width=25
Element Seqn Id St Int Rpt
RYQPEGGRDAISIFHYAKGQPYIDE MYP0_RAT 67 0 -
RYQPEGGRDAISIFHYAKGQPYIDE MYP0_MOUSE 67 0 -
RYQPEGGRDAISIFHYAKGQPYIDE MYP0_BOVIN 38 0 -
RYQPEGGRDAISIFHYAKGQPYIDE MYP0_HUMAN 67 0 -
RFRPDNSRDIISIFHYGNGVPYIEK MYP0_HETFR 65 0 -

Motif 3 width=28
Element Seqn Id St Int Rpt
VGTFKERIQWVGDPSWKDGSIVIHNLDY MYP0_RAT 92 0 -
VGAFKERIQWVGDPRWKDGSIVIHNLDY MYP0_MOUSE 92 0 -
VGTFKERIQWVGDPHRKDGSIVIHNLDY MYP0_BOVIN 63 0 -
VGTFKERIQWVGDPRWKDGSIVIHNLDY MYP0_HUMAN 92 0 -
WGQFRGRVEWVGDISKHDGSIVIRNLDY MYP0_HETFR 90 0 -

Motif 4 width=30
Element Seqn Id St Int Rpt
DNGTFTCDVKNPPDIVGKTSQVTLYVFEKV MYP0_RAT 121 1 -
DNGTFTCDVKNPPDIVGKTSQVTLYVFEKV MYP0_MOUSE 121 1 -
DNGTFTCDVKNPPDIVGKTSQVTLYVFEKV MYP0_BOVIN 92 1 -
DNGTFTCDVKNPPDIVGKTSQVTLYVFEKV MYP0_HUMAN 121 1 -
DNGTFTCDVKNPPDVVGTSSDVHLTVYDKI MYP0_HETFR 119 1 -

Motif 5 width=25
Element Seqn Id St Int Rpt
GVVLGAVIGGILGVVLLLLLLFYLI MYP0_RAT 155 4 -
GVVLGAVIGGILGVVLLLLLLFYLI MYP0_MOUSE 155 4 -
GVVLGAVIGGVLGVVLLALLLFYLI MYP0_BOVIN 126 4 -
GVVLGAVIGGVLGVVLLLLLLFYVV MYP0_HUMAN 155 4 -
GVVSGAIIGTFLGIILLIVGGLYLF MYP0_HETFR 154 5 -

Motif 6 width=22
Element Seqn Id St Int Rpt
PVLYAMLDHSRSTKAASEKKSK MYP0_RAT 217 37 -
PVLYAMLDHSRSTKAASEKKSK MYP0_MOUSE 217 37 -
PVLYAMLDHSRSTKAASEKKTK MYP0_BOVIN 188 37 -
PVLYAMLDHSRSTKAVSEKKAK MYP0_HUMAN 217 37 -
PVLYATLDQSKSGKGASEKKSK MYP0_HETFR 216 37 -
Final Motifs
Motif 1  width=25
Element Seqn Id St Int Rpt
VGSQVTLHCSFWSSEWVSDDISFTW MYP0_RAT 42 42 -
VGSQVTLHCSFWSSEWVSDDISFTW MYP0_MOUSE 42 42 -
VGSQVTLYCSFWSSEWVSDDLSFTW MYP0_BOVIN 13 13 -
VGSRVTLHCSFWSSEWVSDDISFTW MYP0_HUMAN 42 42 -
VGSHVTLSCSFWSSEWISEDISYTW MYP0_CHICK 42 42 -
VGSDVTLYCGFWSNEYVSDLTTLSW MYP0_HETFR 40 40 -

Motif 2 width=25
Element Seqn Id St Int Rpt
RYQPEGGRDAISIFHYAKGQPYIDE MYP0_RAT 67 0 -
RYQPEGGRDAISIFHYAKGQPYIDE MYP0_MOUSE 67 0 -
RYQPEGGRDAISIFHYAKGQPYIDE MYP0_BOVIN 38 0 -
RYQPEGGRDAISIFHYAKGQPYIDE MYP0_HUMAN 67 0 -
HFQAEGSRDSISIFHYGKGQPYIDD MYP0_CHICK 67 0 -
RFRPDNSRDIISIFHYGNGVPYIEK MYP0_HETFR 65 0 -

Motif 3 width=28
Element Seqn Id St Int Rpt
VGTFKERIQWVGDPSWKDGSIVIHNLDY MYP0_RAT 92 0 -
VGAFKERIQWVGDPRWKDGSIVIHNLDY MYP0_MOUSE 92 0 -
VGTFKERIQWVGDPHRKDGSIVIHNLDY MYP0_BOVIN 63 0 -
VGTFKERIQWVGDPRWKDGSIVIHNLDY MYP0_HUMAN 92 0 -
VGSFKERMEWVGNPRRKDGSIVIHNLDY MYP0_CHICK 92 0 -
WGQFRGRVEWVGDISKHDGSIVIRNLDY MYP0_HETFR 90 0 -

Motif 4 width=30
Element Seqn Id St Int Rpt
DNGTFTCDVKNPPDIVGKTSQVTLYVFEKV MYP0_RAT 121 1 -
DNGTFTCDVKNPPDIVGKTSQVTLYVFEKV MYP0_MOUSE 121 1 -
DNGTFTCDVKNPPDIVGKTSQVTLYVFEKV MYP0_BOVIN 92 1 -
DNGTFTCDVKNPPDIVGKTSQVTLYVFEKV MYP0_HUMAN 121 1 -
DNGTFTCDVKNPPDIVGKSSQVTLYVLEKV MYP0_CHICK 121 1 -
DNGTFTCDVKNPPDVVGTSSDVHLTVYDKI MYP0_HETFR 119 1 -

Motif 5 width=25
Element Seqn Id St Int Rpt
GVVLGAVIGGILGVVLLLLLLFYLI MYP0_RAT 155 4 -
GVVLGAVIGGILGVVLLLLLLFYLI MYP0_MOUSE 155 4 -
GVVLGAVIGGVLGVVLLALLLFYLI MYP0_BOVIN 126 4 -
GVVLGAVIGGVLGVVLLLLLLFYVV MYP0_HUMAN 155 4 -
GVVLGSIIGGVLLLVALLVAVVYLV MYP0_CHICK 155 4 -
GVVSGAIIGTFLGIILLIVGGLYLF MYP0_HETFR 154 5 -

Motif 6 width=22
Element Seqn Id St Int Rpt
PVLYAMLDHSRSTKAASEKKSK MYP0_RAT 217 37 -
PVLYAMLDHSRSTKAASEKKSK MYP0_MOUSE 217 37 -
PVLYAMLDHSRSTKAASEKKTK MYP0_BOVIN 188 37 -
PVLYAMLDHSRSTKAVSEKKAK MYP0_HUMAN 217 37 -
PVLYAMLDHSRSAKAAAEKKSK MYP0_CHICK 217 37 -
PVLYATLDQSKSGKGASEKKSK MYP0_HETFR 216 37 -