SPRINT Home UMBER Home Contents Standard Search Advanced Search Relation Search

==SPRINT==> PRINTS View



  selected as


PR00174

Identifier
LACYSMPORT  [View Relations]  [View Alignment]  
Accession
PR00174
No. of Motifs
8
Creation Date
07-JUL-1994  (UPDATE 06-JUL-2009)
Title
LacY proton/sugar symporter family signature
Database References

PROSITE; PS00896 LACY_1; PS00897 LACY_2
BLOCKS; BL00896
PFAM; PF01306 LacY_symp
INTERPRO; IPR000576
Literature References
1. MARGER, M.D. AND SAIER, M.H.
A major superfamily of transmembrane facilitators that catalyse uniport, 
symport and antiport.
TRENDS BIOCHEM.SCI. 18 13-20 (1993).
 
2. BOCKMANN, J., HEUEL, H. AND LENGELER, J.W.
Characterization of a chromosomally encoded, non-PTS metabolic pathway for
sucrose utilization in Escherichia coli EC3132.
MOL.GEN.GENET. 235 22-32 (1992).

Documentation
Bacteria contain a number of different sugar transporter families,
including symporters and antiporters [1]. The lacY family of E.coli and
Klebsiella pneumoniae are proton/beta-galactoside symporters, which, like
most sugar transporters, are predicted as having 12 transmembrane (TM)
regions. Also similar to the lacY family are the rafinose (rafB) and
sucrose (cscB) permeases from E.coli [2].
 
LACYSMPORT is an 8-element fingerprint that provides a signature for the 
lacY proton/sugar symporter family. The fingerprint was derived from an
initial alignment of 4 sequences: motifs were drawn from the TM domains, 
motifs 1-3 TM regions 3-5, and motifs 4-8 regions 7-11 (TM domains 1, 2, 6 
and 12 were too poorly conserved to be included in the fingerprint) - 
motif 1 and motifs 5 and 6 include part of the regions described by PROSITE
patterns LACY_1 (PS00896) and LACY_2 (PS00897). A single iteration on
OWL23.2 was required to reach convergence, no new sequences being identified
beyond the starting set. A single partial match was also found, KPNLAC1, a
lacY protein fragment from Klebsiella.
 
An update on SPTR57_40f identified a true set of 137 sequences. Several
partial matches were also found, all of which are family members that
fail to make significant matches with 2 or more motifs.
Summary Information
 137 codes involving  8 elements
0 codes involving 7 elements
5 codes involving 6 elements
2 codes involving 5 elements
2 codes involving 4 elements
1 codes involving 3 elements
0 codes involving 2 elements
Composite Feature Index
8137137137137137137137137
700000000
622553553
520021221
421120110
301110000
200000000
12345678
True Positives
A1A2J7_BIFAA  A1A830_ECOK1  A4TKH0_YERPP  A4WEG3_ENT38  
A4WGA1_ENT38 A6T8W9_KLEP7 A6TDI9_KLEP7 A6TG99_KLEP7
A6THD0_KLEP7 A6TI28_KLEP7 A6VP59_ACTSZ A7A8U1_BIFAD
A7FJD5_YERP3 A7KGA6_KLEPN A7ML49_ENTS8 A7MN75_ENTS8
A7Z937_BACA2 A7ZI90_ECO24 A7ZPG6_ECO24 A7ZRF1_ECO24
A7ZWZ0_ECOHS A8AGB7_CITK8 A8AJA2_CITK8 A8APR2_CITK8
A8GDJ6_SERP5 A8GGG2_SERP5 A9MER2_SALAR A9MQ81_SALAR
A9R608_YERPG A9ZF02_YERPE A9ZTX2_YERPE B0GG82_YERPE
B0GWG6_YERPE B0HBS1_YERPE B0HG07_YERPE B0HZV4_YERPE
B1J0T6_ECOLC B1JPS6_YERPY B1LDI0_ECOSM B1LIM8_ECOSM
B1S729_9BIFI B1VC73_ECOLX B1XBJ1_ECODH B2EB37_BIFAN
B2JZT5_YERPB B2NM43_ECO57 B2NT36_ECO57 B2P3E0_ECO57
B2P5K4_ECO57 B2PIY4_ECO57 B2PPQ5_ECO57 B2PZH0_PROST
B2VEG9_ERWT9 B3A810_ECO57 B3ABN9_ECO57 B3AQR7_ECO57
B3ATT0_ECO57 B3B2R6_ECO57 B3B6I8_ECO57 B3BHI4_ECO57
B3BKY7_ECO57 B3BX93_ECO57 B3BZQ7_ECO57 B3DQ71_BIFLD
B3H951_ECOLX B3H9P2_ECOLX B3HW85_ECOLX B3HWW5_ECOLX
B3I1M8_ECOLX B3I6X4_ECOLX B3IM37_ECOLX B3WLC9_ECOLX
B3WP35_ECOLX B3X2I6_SHIDY B3XFD5_ECOLX B4ETB8_PROMH
B5XQY3_KLEP3 B5XUM4_KLEP3 B5XZ61_KLEP3 B5Y2Z0_KLEP3
B5Z2P6_ECO5E B6FHW1_9ENTR B6HZW9_ECOSE B6I6R2_ECOSE
B6X3P1_9ENTR B6XE03_9ENTR B6ZQV6_ECO57 B6ZXA4_ECO57
B7B2U4_9FIRM B7GQ11_BIFLI B7L4Z9_ECO55 B7LBR4_ECO55
B7M2Z1_ECO8A B7M6N0_ECO8A B7MD16_ECO45 B7MPB0_ECO55
B7N5W1_ECOLU B7N8Q0_ECOLU B7NK12_ECO7I B7UG72_ECO27
B7UJI8_ECO27 B8DSY1_BIFAN B8LFD7_ECOLI B9AT88_BIFBR
CSCB_ECOLI LACY_CITFR LACY_ECOLI LACY_KLEPN
P96517 Q0TFA0_ECOL5 Q0TKT2_ECOL5 Q1C9M5_YERPA
Q1CH05_YERPN Q1RFJ3_ECOUT Q3YZH1_SHISS Q4J585_AZOVI
Q4J5B8_AZOVI Q4KBP0_PSEF5 Q564C6_BIFAN Q5I3L7_ECOLX
Q62NP8_BACLD Q65D72_BACLD Q65UE6_MANSM Q66C07_YERPS
Q6D737_ERWCT Q6D966_ERWCT Q74V62_YERPE Q7WZY9_ECOLX
Q84F23_BIFAN Q8D088_YERPE Q8FKG7_ECOL6 Q8G7X9_BIFLO
Q8GM37_BACME Q8X4M4_ECO57 Q8XCL1_ECO57 Q97IW0_CLOAB
RAFB_ECOLI
True Positive Partials
Codes involving 6 elements
A4IV35_YERPE A6T6T2_KLEP7 A9Z8T1_YERPE B5XYQ1_KLEP3
Q849X6_ECOLX
Codes involving 5 elements
A0NIT9_OENOE Q03PQ6_LACBA
Codes involving 4 elements
A9QST0_LACLA Q2NS47_SODGM
Codes involving 3 elements
Q4JDM0_BIFBR
Sequence Titles
A1A2J7_BIFAA Sucrose transport protein - Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083). 
A1A830_ECOK1 Galactoside permease - Escherichia coli O1:K1 / APEC.
A4TKH0_YERPP Putative uncharacterized protein - Yersinia pestis (strain Pestoides F).
A4WEG3_ENT38 Oligosaccharide/H+ symporter, major facilitator superfamily (MFS) - Enterobacter sp. (strain 638).
A4WGA1_ENT38 Oligosaccharide/H+ symporter, major facilitator superfamily (MFS) - Enterobacter sp. (strain 638).
A6T8W9_KLEP7 Putative proton/sugar symporter, LacY - Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578).
A6TDI9_KLEP7 Putative galactoside permease (Lactose permease, M protein) (MFS family) - Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578).
A6TG99_KLEP7 Putative proton/sugar symporter, LacY - Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578).
A6THD0_KLEP7 Putative proton/sugar symporter, LacY - Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578).
A6TI28_KLEP7 Galactoside permease (Lactose permease, M protein) (MFS family) - Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578).
A6VP59_ACTSZ Oligosaccharide/H+ symporter, major facilitator superfamily (MFS) - Actinobacillus succinogenes (strain ATCC 55618 / 130Z).
A7A8U1_BIFAD Putative uncharacterized protein - Bifidobacterium adolescentis L2-32.
A7FJD5_YERP3 Lactose permease - Yersinia pseudotuberculosis serotype O:1b (strain IP 31758).
A7KGA6_KLEPN LacY - Klebsiella pneumoniae.
A7ML49_ENTS8 Putative uncharacterized protein - Enterobacter sakazakii (strain ATCC BAA-894).
A7MN75_ENTS8 Putative uncharacterized protein - Enterobacter sakazakii (strain ATCC BAA-894).
A7Z937_BACA2 YwbF - Bacillus amyloliquefaciens (strain FZB42).
A7ZI90_ECO24 Lactose permease - Escherichia coli O139:H28 (strain E24377A / ETEC).
A7ZPG6_ECO24 Oligosaccharide:H+ symporter - Escherichia coli O139:H28 (strain E24377A / ETEC).
A7ZRF1_ECO24 Raffinose permease - Escherichia coli O139:H28 (strain E24377A / ETEC).
A7ZWZ0_ECOHS Lactose permease - Escherichia coli O9:H4 (strain HS).
A8AGB7_CITK8 Putative uncharacterized protein - Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696).
A8AJA2_CITK8 Putative uncharacterized protein - Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696).
A8APR2_CITK8 Putative uncharacterized protein - Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696).
A8GDJ6_SERP5 Oligosaccharide/H+ symporter, major facilitator superfamily (MFS) - Serratia proteamaculans (strain 568).
A8GGG2_SERP5 Oligosaccharide/H+ symporter, major facilitator superfamily (MFS) - Serratia proteamaculans (strain 568).
A9MER2_SALAR Putative uncharacterized protein - Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980).
A9MQ81_SALAR Putative uncharacterized protein - Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980).
A9R608_YERPG Lactose permease - Yersinia pestis bv. Antiqua (strain Angola).
A9ZF02_YERPE Lactose permease (Lactose-proton symport) - Yersinia pestis biovar Orientalis str. IP275.
A9ZTX2_YERPE Lactose permease (Lactose-proton symport) - Yersinia pestis biovar Orientalis str. F1991016.
B0GG82_YERPE Lactose permease (Lactose-proton symport) - Yersinia pestis biovar Antiqua str. UG05-0454.
B0GWG6_YERPE Lactose permease (Lactose-proton symport) - Yersinia pestis biovar Orientalis str. MG05-1020.
B0HBS1_YERPE Lactose permease (Lactose-proton symport) - Yersinia pestis biovar Mediaevalis str. K1973002.
B0HG07_YERPE Lactose permease (Lactose-proton symport) - Yersinia pestis biovar Antiqua str. B42003004.
B0HZV4_YERPE Lactose permease (Lactose-proton symport) - Yersinia pestis biovar Antiqua str. E1979001.
B1J0T6_ECOLC Oligosaccharide/H+ symporter, major facilitator superfamily (MFS) - Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks).
B1JPS6_YERPY Oligosaccharide/H+ symporter, major facilitator superfamily (MFS) - Yersinia pseudotuberculosis serotype O:3 (strain YPIII).
B1LDI0_ECOSM Raffinose permease - Escherichia coli (strain SMS-3-5 / SECEC).
B1LIM8_ECOSM Lactose permease - Escherichia coli (strain SMS-3-5 / SECEC).
B1S729_9BIFI Putative uncharacterized protein - Bifidobacterium dentium ATCC 27678.
B1VC73_ECOLX RafB protein - Escherichia coli.
B1XBJ1_ECODH Lactose/galactose transporter - Escherichia coli (strain DH10B).
B2EB37_BIFAN Galactoside permease - Bifidobacterium animalis subsp. lactis HN019.
B2JZT5_YERPB Oligosaccharide/H+ symporter, major facilitator superfamily (MFS) - Yersinia pseudotuberculosis serotype IB (strain PB1/+).
B2NM43_ECO57 Oligosaccharide:H+ symporter - Escherichia coli O157:H7 str. EC4196.
B2NT36_ECO57 Lactose permease - Escherichia coli O157:H7 str. EC4196.
B2P3E0_ECO57 Oligosaccharide:H+ symporter - Escherichia coli O157:H7 str. EC4113.
B2P5K4_ECO57 Lactose permease - Escherichia coli O157:H7 str. EC4113.
B2PIY4_ECO57 Oligosaccharide:H+ symporter - Escherichia coli O157:H7 str. EC4076.
B2PPQ5_ECO57 Lactose permease - Escherichia coli O157:H7 str. EC4076.
B2PZH0_PROST Putative uncharacterized protein - Providencia stuartii ATCC 25827.
B2VEG9_ERWT9 Raffinose permease - Erwinia tasmaniensis (strain DSM 17950 / Et1/99).
B3A810_ECO57 Lactose permease - Escherichia coli O157:H7 str. EC4401.
B3ABN9_ECO57 Oligosaccharide:H+ symporter - Escherichia coli O157:H7 str. EC4401.
B3AQR7_ECO57 Lactose permease - Escherichia coli O157:H7 str. EC4486.
B3ATT0_ECO57 Oligosaccharide:H+ symporter - Escherichia coli O157:H7 str. EC4486.
B3B2R6_ECO57 Lactose permease - Escherichia coli O157:H7 str. EC4501.
B3B6I8_ECO57 Oligosaccharide:H+ symporter - Escherichia coli O157:H7 str. EC4501.
B3BHI4_ECO57 Oligosaccharide:H+ symporter - Escherichia coli O157:H7 str. EC869.
B3BKY7_ECO57 Lactose permease - Escherichia coli O157:H7 str. EC869.
B3BX93_ECO57 Lactose permease - Escherichia coli O157:H7 str. EC508.
B3BZQ7_ECO57 Oligosaccharide:H+ symporter - Escherichia coli O157:H7 str. EC508.
B3DQ71_BIFLD Cyanate permease - Bifidobacterium longum (strain DJO10A).
B3H951_ECOLX Oligosaccharide:H+ symporter - Escherichia coli B7A.
B3H9P2_ECOLX Lactose permease - Escherichia coli B7A.
B3HW85_ECOLX Lactose permease - Escherichia coli F11.
B3HWW5_ECOLX Oligosaccharide:H+ symporter - Escherichia coli F11.
B3I1M8_ECOLX Oligosaccharide:H+ symporter - Escherichia coli E22.
B3I6X4_ECOLX Lactose permease - Escherichia coli E22.
B3IM37_ECOLX Oligosaccharide:H+ symporter - Escherichia coli E110019.
B3WLC9_ECOLX Lactose permease - Escherichia coli B171.
B3WP35_ECOLX Oligosaccharide:H+ symporter - Escherichia coli B171.
B3X2I6_SHIDY Raffinose permease - Shigella dysenteriae 1012.
B3XFD5_ECOLX Lactose permease - Escherichia coli 101-1.
B4ETB8_PROMH MFS-family transporter - Proteus mirabilis (strain HI4320).
B5XQY3_KLEP3 Lactose permease - Klebsiella pneumoniae (strain 342).
B5XUM4_KLEP3 Oligosaccharide:H+ symporter - Klebsiella pneumoniae (strain 342).
B5XZ61_KLEP3 Raffinose permease - Klebsiella pneumoniae (strain 342).
B5Y2Z0_KLEP3 Oligosaccharide:H+ symporter - Klebsiella pneumoniae (strain 342).
B5Z2P6_ECO5E Lactose permease - Escherichia coli O157:H7 (strain EC4115 / EHEC).
B6FHW1_9ENTR Putative uncharacterized protein - Enterobacter cancerogenus ATCC 35316.
B6HZW9_ECOSE Galactoside transport protein LacY - Escherichia coli (strain SE11).
B6I6R2_ECOSE Sucrose transport protein - Escherichia coli (strain SE11).
B6X3P1_9ENTR Putative uncharacterized protein - Providencia rustigianii DSM 4541.
B6XE03_9ENTR Putative uncharacterized protein - Providencia alcalifaciens DSM 30120.
B6ZQV6_ECO57 Lactose permease - Escherichia coli O157:H7 str. TW14588.
B6ZXA4_ECO57 Oligosaccharide:H+ symporter - Escherichia coli O157:H7 str. TW14588.
B7B2U4_9FIRM Putative uncharacterized protein - Mitsuokella multacida DSM 20544.
B7GQ11_BIFLI Oligosaccharide/H+ symporter, major facilitator superfamily (MFS) - Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / NCTC 11817 / S12).
B7L4Z9_ECO55 Lactose/galactose transporter - Escherichia coli (strain 55989 / EAEC).
B7LBR4_ECO55 Sucrose transport protein (Sucrose permease) - Escherichia coli (strain 55989 / EAEC).
B7M2Z1_ECO8A Lactose/galactose transporter - Escherichia coli O8 (strain IAI1).
B7M6N0_ECO8A Sucrose transport protein (Sucrose permease) - Escherichia coli O8 (strain IAI1).
B7MD16_ECO45 Lactose/galactose transporter - Escherichia coli O45:K1 (strain S88 / ExPEC).
B7MPB0_ECO55 Lactose/galactose transporter - Escherichia coli (strain 55989 / EAEC).
B7N5W1_ECOLU Sucrose transport protein (Sucrose permease) - Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC).
B7N8Q0_ECOLU Lactose/galactose transporter - Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC).
B7NK12_ECO7I Lactose/galactose transporter - Escherichia coli O7:K1 (strain IAI39 / ExPEC).
B7UG72_ECO27 Sucrose transport protein - Escherichia coli O127:H6 str. E2348/69.
B7UJI8_ECO27 Lactose/galactose transporter - Escherichia coli O127:H6 str. E2348/69.
B8DSY1_BIFAN Sugar transport protein - Bifidobacterium animalis subsp. lactis AD011.
B8LFD7_ECOLI Galactoside permease - Escherichia coli (strain K12).
B9AT88_BIFBR Putative uncharacterized protein - Bifidobacterium breve DSM 20213.
CSCB_ECOLI SUCROSE TRANSPORT PROTEIN (SUCROSE PERMEASE) - ESCHERICHIA COLI.
LACY_CITFR Lactose permease - Citrobacter freundii.
LACY_ECOLI Lactose permease - Escherichia coli (strain K12).
LACY_KLEPN LACTOSE PERMEASE (LACTOSE-PROTON SYMPORT) - KLEBSIELLA PNEUMONIAE.
P96517 MELY - ENTEROBACTER CLOACAE.
Q0TFA0_ECOL5 Sucrose transport protein - Escherichia coli O6:K15:H31 (strain 536 / UPEC).
Q0TKT2_ECOL5 Lactose permease - Escherichia coli O6:K15:H31 (strain 536 / UPEC).
Q1C9M5_YERPA Putative uncharacterized protein - Yersinia pestis bv. Antiqua (strain Antiqua).
Q1CH05_YERPN Putative uncharacterized protein - Yersinia pestis bv. Antiqua (strain Nepal516).
Q1RFJ3_ECOUT Lactose permease - Escherichia coli (strain UTI89 / UPEC).
Q3YZH1_SHISS Sucrose permease - Shigella sonnei (strain Ss046).
Q4J585_AZOVI Proton/sugar symporter, LacY - Azotobacter vinelandii DJ.
Q4J5B8_AZOVI Proton/sugar symporter, LacY - Azotobacter vinelandii DJ.
Q4KBP0_PSEF5 Sugar transporter FruP - Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477).
Q564C6_BIFAN Sugar transport protein - Bifidobacterium animalis subsp. lactis.
Q5I3L7_ECOLX Aec46 - Escherichia coli.
Q62NP8_BACLD Putative sugar permease YwbF - Bacillus licheniformis (strain DSM 13 / ATCC 14580).
Q65D72_BACLD YwbF - Bacillus licheniformis (strain DSM 13 / ATCC 14580).
Q65UE6_MANSM ProP protein - Mannheimia succiniciproducens (strain MBEL55E).
Q66C07_YERPS MFS lactose lactose-proton symporter - Yersinia pseudotuberculosis.
Q6D737_ERWCT Lactose permease - Erwinia carotovora subsp. atroseptica (Pectobacterium atrosepticum).
Q6D966_ERWCT Putative raffinose permease - Erwinia carotovora subsp. atroseptica (Pectobacterium atrosepticum).
Q74V62_YERPE Galactoside permease (M protein) - Yersinia pestis.
Q7WZY9_ECOLX Anion symport for sucrose - Escherichia coli.
Q84F23_BIFAN Sucrose permease - Bifidobacterium animalis subsp. lactis (Bifidobacterium lactis).
Q8D088_YERPE Galactoside permease (M protein) - Yersinia pestis.
Q8FKG7_ECOL6 Lactose permease - Escherichia coli O6.
Q8G7X9_BIFLO Sucrose transport protein - Bifidobacterium longum.
Q8GM37_BACME Sugar transporter FruP - Bacillus megaterium.
Q8X4M4_ECO57 Galactoside permease (M protein) - Escherichia coli O157:H7.
Q8XCL1_ECO57 Sucrose permease (Sucrose transport protein) - Escherichia coli O157:H7.
Q97IW0_CLOAB Sugar-proton symporter - Clostridium acetobutylicum.
RAFB_ECOLI RAFFINOSE PERMEASE - ESCHERICHIA COLI.

A4IV35_YERPE Oligosaccharide:H+ symporter - Yersinia pestis biovar Orientalis str. IP275.
A6T6T2_KLEP7 Putative proton/sugar symporter, LacY - Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578).
A9Z8T1_YERPE Lactose permease (Lactose-proton symport) - Yersinia pestis biovar Orientalis str. IP275.
B5XYQ1_KLEP3 Oligosaccharide:H+ symporter - Klebsiella pneumoniae (strain 342).
Q849X6_ECOLX Putative uncharacterized protein orf43 - Escherichia coli.

A0NIT9_OENOE Sugar-proton symporter - Oenococcus oeni ATCC BAA-1163.
Q03PQ6_LACBA Na+/melibiose symporter related transporter - Lactobacillus brevis (strain ATCC 367 / JCM 1170).

A9QST0_LACLA Putative disaccharide permease - Lactococcus lactis subsp. lactis (Streptococcus lactis).
Q2NS47_SODGM Putative lactose transport protein - Sodalis glossinidius (strain morsitans).

Q4JDM0_BIFBR Putative sucrose permease - Bifidobacterium breve.
Scan History
OWL23_2    1  100  NSINGLE    
OWL26_0 1 100 NSINGLE
SPTR37_9f 2 7 NSINGLE
SPTR57_40f 8 300 NSINGLE
Initial Motifs
Motif 1  width=30
Element Seqn Id St Int Rpt
DKLGLRKYLLWIITGMLVMFAPFFIFIFGP Q8X4M4_ECO57 68 68 -
DKLGLRKYLLWIITGMLVMFAPFFIFIFGP LACY_ECOLI 68 68 -
DKLGLRKHLLWVITGMLVMFAPFFIYVFGP LACY_CITFR 68 68 -
DKLGLKKHLLWIISVLLFLFAPFFLYVFAP P96517 73 73 -
DRLGLKKNLIWSISLLLVFFAPFFLYVFAP RAFB_ECOLI 71 71 -
DKLGLRKHLLWTITILLILFAPFFIFVFSP LACY_KLEPN 73 73 -
DKLGLKKPLIWCMSFILVLTGPFMIYVYEP CSCB_ECOLI 71 71 -
DRIGLKKHVLFFISCLLVFVGPFYIFVYGP Q8GM37_BACME 67 67 -

Motif 2 width=23
Element Seqn Id St Int Rpt
ILVGSIVGGIYLGFCFNAGAPAV Q8X4M4_ECO57 103 5 -
ILVGSIVGGIYLGFCFNAGAPAV LACY_ECOLI 103 5 -
ILLGSIVGGIYLGFIYNAGAPAI LACY_CITFR 103 5 -
IWLGALSGGLYIGFVFSAGSGAI P96517 108 5 -
IWAGALTGGVFIGFVFSAGAGAI RAFB_ECOLI 106 5 -
IMAGALVGGVYLGIVFSSRSGAV LACY_KLEPN 108 5 -
FSVGLILGALFFGLGYLAGCGLL CSCB_ECOLI 106 5 -
VVIGAIIGGLYLGVAFLAGIGAI Q8GM37_BACME 102 5 -

Motif 3 width=19
Element Seqn Id St Int Rpt
MFGCVGWALCASIVGIMFT Q8X4M4_ECO57 145 19 -
MFGCVGWALCASIVGIMFT LACY_ECOLI 145 19 -
MFGCVGWALCASIAGIMFT LACY_CITFR 145 19 -
MFGCLGWGLCASTGGILFG P96517 150 19 -
MFGCLGWALCATMAGILFN RAFB_ECOLI 148 19 -
VSGCVGWALCASITGILFS LACY_KLEPN 150 19 -
AWGSFGYAIGAFFAGIFFS CSCB_ECOLI 148 19 -
MWGSLGWAAATFFAGQLFN Q8GM37_BACME 144 19 -

Motif 4 width=29
Element Seqn Id St Int Rpt
LELFRQPKLWFLSLYVIGVSCTYDVFDQQ Q8X4M4_ECO57 214 50 -
LELFRQPKLWFLSLYVIGVSCTYDVFDQQ LACY_ECOLI 214 50 -
LELFKQPKLWLISLYVVGVSCTYDVFDQQ LACY_CITFR 214 50 -
FNLFRQRRMWMFILYVIGVACVYDVFDQQ P96517 219 50 -
FSLFRMRQMWMFVLYTIGVACVYDVFDQQ RAFB_ECOLI 217 50 -
AELFRMPRFWGFIIYVVGVASVYDVFDQQ LACY_KLEPN 219 50 -
IAVFKDRNFWVFVIFIVGTWSFYNIFDQQ CSCB_ECOLI 211 44 -
GSLFLLKEFWFFMIYVVGVTCVYGVYDQQ Q8GM37_BACME 207 44 -

Motif 5 width=22
Element Seqn Id St Int Rpt
VFGYVTTMGELLNASIMFFAPL Q8X4M4_ECO57 260 17 -
VFGYVTTMGELLNASIMFFAPL LACY_ECOLI 260 17 -
VFGYVTTMGELLNASIMFFAPL LACY_CITFR 260 17 -
AFGFATTAGEICNAIIMFCSPW P96517 265 17 -
AFGFATTAGEICNAIIMFCTPW RAFB_ECOLI 263 17 -
VFGFVTTGGELLNALIMFCAPA LACY_KLEPN 265 17 -
LYGYLNSFQVVLEALCMAIIPF CSCB_ECOLI 258 18 -
VFGYLNSFQVFLEAGMMFAAPF Q8GM37_BACME 253 17 -

Motif 6 width=27
Element Seqn Id St Int Rpt
NRIGGKNALLLAGTIMSVRIIGSSFAT Q8X4M4_ECO57 284 2 -
NRIGGKNALLLAGTIMSVRIIGSSFAT LACY_ECOLI 284 2 -
NRIGGKNALLLAGTIMSVRIIGSHSHT LACY_CITFR 284 2 -
NRIGAKNTLLIAGLIMATRIIGSSFAT P96517 289 2 -
NRIGAKNTLLVAGGIMTIRITGSAFAT RAFB_ECOLI 287 2 -
NRIGAKNALLIAGLIMSVRILGSSFAT LACY_KLEPN 289 2 -
NRVGPKNALLIGVVIMALRILSCALFV CSCB_ECOLI 282 2 -
NKIGAKNSLILAGFLMGFRIIGSGLVV Q8GM37_BACME 277 2 -

Motif 7 width=20
Element Seqn Id St Int Rpt
VVILKTLHMFEVPFLLVGCF Q8X4M4_ECO57 315 4 -
VVILKTLHMFEVPFLLVGCF LACY_ECOLI 315 4 -
VVILKTLHMFEIPFLIVGCF LACY_CITFR 314 3 -
VIALKMLHALEVPFLLVGAF P96517 320 4 -
VVILKMLHALEVPFLLVGAF RAFB_ECOLI 318 4 -
VIILKMLHMFEIPFLLVGTF LACY_KLEPN 320 4 -
ISLVKLLHAIEVPLCVISVF CSCB_ECOLI 313 4 -
ISSMKLIHALELPIMLIAIF Q8GM37_BACME 308 4 -

Motif 8 width=21
Element Seqn Id St Int Rpt
SATIYLVCFCFFKQLAMIFMS Q8X4M4_ECO57 346 11 -
SATIYLVCFCFFKQLAMIFMS LACY_ECOLI 346 11 -
SATIYLVCFCFFKQLAMIFMS LACY_CITFR 345 11 -
SATIYLIGFQFAKQSAAIFLS P96517 351 11 -
SATVYLIGFQFSKQLAAILLS RAFB_ECOLI 349 11 -
SATLFLIGFNLSKQLSSVVLS LACY_KLEPN 351 11 -
SSTIFLIGFQIASSLGIVLLS CSCB_ECOLI 344 11 -
SSILYLVGFQFASQIGASVLS Q8GM37_BACME 339 11 -
Final Motifs
Motif 1  width=30
Element Seqn Id St Int Rpt
DKLGLRKYLLWIITGMLVMFAPFFIFIFGP A1A830_ECOK1 68 68 -
DKLGLRKYLLWIITGMLVMFAPFFIFIFGP Q8X4M4_ECO57 68 68 -
DKLGLRKYLLWIITGMLVMFAPFFIFIFGP Q8FKG7_ECOL6 68 68 -
DKLGLRKYLLWIITGMLVMFAPFFIFIFGP Q1RFJ3_ECOUT 68 68 -
DKLGLRKYLLWIITGMLVMFAPFFIFIFGP Q0TKT2_ECOL5 68 68 -
DKLGLRKYLLWIITGMLVMFAPFFIFIFGP LACY_ECOLI 68 68 -
DKLGLRKYLLWIITGMLVMFAPFFIFIFGP B8LFD7_ECOLI 46 46 -
DKLGLRKYLLWIITGMLVMFAPFFIFIFGP B7UJI8_ECO27 68 68 -
DKLGLRKYLLWIITGMLVMFAPFFIFIFGP B7N8Q0_ECOLU 68 68 -
DKLGLRKYLLWIITGMLVMFAPFFIFIFGP B7MPB0_ECO55 68 68 -
DKLGLRKYLLWIITGMLVMFAPFFIFIFGP B7MD16_ECO45 68 68 -
DKLGLRKYLLWIITGMLVMFAPFFIFIFGP B7L4Z9_ECO55 68 68 -
DKLGLRKYLLWIITGMLVMFAPFFIFIFGP B6ZQV6_ECO57 68 68 -
DKLGLRKYLLWIITGMLVMFAPFFIFIFGP B6HZW9_ECOSE 68 68 -
DKLGLRKYLLWIITGMLVMFAPFFIFIFGP B5Z2P6_ECO5E 68 68 -
DKLGLRKYLLWIITGMLVMFAPFFIFIFGP B3XFD5_ECOLX 68 68 -
DKLGLRKYLLWIITGMLVMFAPFFIFIFGP B3WLC9_ECOLX 68 68 -
DKLGLRKYLLWIITGMLVMFAPFFIFIFGP B3I6X4_ECOLX 68 68 -
DKLGLRKYLLWIITGMLVMFAPFFIFIFGP B3HW85_ECOLX 68 68 -
DKLGLRKYLLWIITGMLVMFAPFFIFIFGP B3H9P2_ECOLX 68 68 -
DKLGLRKYLLWIITGMLVMFAPFFIFIFGP B3BX93_ECO57 68 68 -
DKLGLRKYLLWIITGMLVMFAPFFIFIFGP B3BKY7_ECO57 68 68 -
DKLGLRKYLLWIITGMLVMFAPFFIFIFGP B3B2R6_ECO57 68 68 -
DKLGLRKYLLWIITGMLVMFAPFFIFIFGP B3AQR7_ECO57 68 68 -
DKLGLRKYLLWIITGMLVMFAPFFIFIFGP B3A810_ECO57 68 68 -
DKLGLRKYLLWIITGMLVMFAPFFIFIFGP B2PPQ5_ECO57 68 68 -
DKLGLRKYLLWIITGMLVMFAPFFIFIFGP B2P5K4_ECO57 68 68 -
DKLGLRKYLLWIITGMLVMFAPFFIFIFGP B2NT36_ECO57 68 68 -
DKLGLRKYLLWIITGMLVMFAPFFIFIFGP B1XBJ1_ECODH 68 68 -
DKLGLRKYLLWIITGMLVMFAPFFIFIFGP B1LIM8_ECOSM 68 68 -
DKLGLRKYLLWIITGMLVMFAPFFIFIFGP B1J0T6_ECOLC 68 68 -
DKLGLRKYLLWIITGMLVMFAPFFIFIFGP A7ZWZ0_ECOHS 68 68 -
DKLGLRKYLLWIITGMLVMFAPFFIFIFGP A7ZI90_ECO24 68 68 -
DKLGLRKYLLWIITGMLVMFAPFFIFIFGP A7KGA6_KLEPN 68 68 -
DKLGLRKYLLWIITGMLVMFAPFFIFIFGP A6TI28_KLEP7 68 68 -
DKLGLRKYLLWIITGMLVMFAPFFIFIFGP B7M2Z1_ECO8A 68 68 -
DKLGLRKYLLWIITGMLVMFAPFFIFIFGP B7NK12_ECO7I 68 68 -
DKLGLRKNLLWIITGMLVMFAPFFIYVFGP A9MQ81_SALAR 68 68 -
DKLGLRKHLLWVITGMLVMFAPFFIYVFGP LACY_CITFR 68 68 -
DKLGLRKTLMWIIVGLLVLFAPFFIYVFSP A4TKH0_YERPP 75 75 -
DKLGLRKTLMWIIVGLLVLFAPFFIYVFSP Q8D088_YERPE 54 54 -
DKLGLRKTLMWIIVGLLVLFAPFFIYVFSP Q74V62_YERPE 75 75 -
DKLGLRKTLMWIIVGLLVLFAPFFIYVFSP Q66C07_YERPS 75 75 -
DKLGLRKTLMWIIVGLLVLFAPFFIYVFSP Q1CH05_YERPN 46 46 -
DKLGLRKTLMWIIVGLLVLFAPFFIYVFSP Q1C9M5_YERPA 46 46 -
DKLGLRKTLMWIIVGLLVLFAPFFIYVFSP B2JZT5_YERPB 75 75 -
DKLGLRKTLMWIIVGLLVLFAPFFIYVFSP B1JPS6_YERPY 75 75 -
DKLGLRKTLMWIIVGLLVLFAPFFIYVFSP B0HZV4_YERPE 46 46 -
DKLGLRKTLMWIIVGLLVLFAPFFIYVFSP B0HG07_YERPE 46 46 -
DKLGLRKTLMWIIVGLLVLFAPFFIYVFSP B0HBS1_YERPE 46 46 -
DKLGLRKTLMWIIVGLLVLFAPFFIYVFSP B0GWG6_YERPE 46 46 -
DKLGLRKTLMWIIVGLLVLFAPFFIYVFSP B0GG82_YERPE 46 46 -
DKLGLRKTLMWIIVGLLVLFAPFFIYVFSP A9ZTX2_YERPE 46 46 -
DKLGLRKTLMWIIVGLLVLFAPFFIYVFSP A9ZF02_YERPE 46 46 -
DKLGLRKTLMWIIVGLLVLFAPFFIYVFSP A9R608_YERPG 75 75 -
DKLGLRKTLMWIIVGLLVLFAPFFIYVFSP A7FJD5_YERP3 75 75 -
DKLGLRKHLLWIITIMLVFFAPFFIYVFGP Q6D737_ERWCT 68 68 -
DKLGLKKHLLWIITTLLVLFAPFFLWVFGP A7ML49_ENTS8 73 73 -
DKLGLKKHLLWIISVLLFLFAPFFLYVFAP P96517 73 73 -
DRLGLKKNLIWSISLLLVFFAPFFLYVFAP RAFB_ECOLI 71 71 -
DKLGLRKHLLWTITVLLILFAPFFIFVFSP A6T8W9_KLEP7 75 75 -
DKLGLRKHLLWTITILLILFAPFFIFVFSP LACY_KLEPN 73 73 -
DKLGLRKHLLWTITVLLILFAPFFIFVFSP B5XQY3_KLEP3 73 73 -
DKLGLRKHLLWTITGLLVLFAPFFIFVLKP A7MN75_ENTS8 73 73 -
DKLGLKKHLLWIIAVLLFLFAPFFLYVFAP A4WGA1_ENT38 73 73 -
DRLGLKKNLIWSISLLLVFFAPFFLYVFAP B1VC73_ECOLX 71 71 -
DRLGLKKNLIWSISLLLVFFAPFFLYVFAP B3X2I6_SHIDY 71 71 -
DRLGLKKNLIWSISLLLVFFAPFFLYVFAP A7ZRF1_ECO24 76 76 -
DRLGLKKNLIWSISLLLVFFAPFFLYVFAP B1LDI0_ECOSM 71 71 -
DKLGLKKHLMWIVTVLLVLIAPFFLYVFAP A6TG99_KLEP7 73 73 -
DKLGLKKHLMWIVTVLLVLIAPFFLYVFAP B5XZ61_KLEP3 73 73 -
DKFGLKKHLLWMIIFLLLFLAPLFIYVFSP A8GGG2_SERP5 68 68 -
DKLGMKKHLLWVISVLLLFFAPFFLYVFAP Q6D966_ERWCT 73 73 -
DKLGVRKHLLWILAFTLIFYAPFFIYVFAP A6VP59_ACTSZ 76 76 -
DKLGLKKHLLWVLGISLLIYAPFFIYIFAP Q65UE6_MANSM 84 84 -
DKLGLKKPLIWCMSFILVLTGPFMIYVYEP A7ZPG6_ECO24 71 71 -
DKLGLKKPLIWCMSFILVLTGPFMIYVYEP Q8XCL1_ECO57 71 71 -
DKLGLKKPLIWCMSFILVLTGPFMIYVYEP Q7WZY9_ECOLX 71 71 -
DKLGLKKPLIWCMSFILVLTGPFMIYVYEP Q3YZH1_SHISS 71 71 -
DKLGLKKPLIWCMSFILVLTGPFMIYVYEP Q0TFA0_ECOL5 71 71 -
DKLGLKKPLIWCMSFILVLTGPFMIYVYEP CSCB_ECOLI 71 71 -
DKLGLKKPLIWCMSFILVLTGPFMIYVYEP B7N5W1_ECOLU 71 71 -
DKLGLKKPLIWCMSFILVLTGPFMIYVYEP B7M6N0_ECO8A 71 71 -
DKLGLKKPLIWCMSFILVLTGPFMIYVYEP B7LBR4_ECO55 71 71 -
DKLGLKKPLIWCMSFILVLTGPFMIYVYEP B6ZXA4_ECO57 71 71 -
DKLGLKKPLIWCMSFILVLTGPFMIYVYEP B6I6R2_ECOSE 71 71 -
DKLGLKKPLIWCMSFILVLTGPFMIYVYEP B3WP35_ECOLX 71 71 -
DKLGLKKPLIWCMSFILVLTGPFMIYVYEP B3IM37_ECOLX 71 71 -
DKLGLKKPLIWCMSFILVLTGPFMIYVYEP B3I1M8_ECOLX 71 71 -
DKLGLKKPLIWCMSFILVLTGPFMIYVYEP B3HWW5_ECOLX 71 71 -
DKLGLKKPLIWCMSFILVLTGPFMIYVYEP B3H951_ECOLX 71 71 -
DKLGLKKPLIWCMSFILVLTGPFMIYVYEP B3BHI4_ECO57 71 71 -
DKLGLKKPLIWCMSFILVLTGPFMIYVYEP B3B6I8_ECO57 71 71 -
DKLGLKKPLIWCMSFILVLTGPFMIYVYEP B3ATT0_ECO57 71 71 -
DKLGLKKPLIWCMSFILVLTGPFMIYVYEP B3ABN9_ECO57 71 71 -
DKLGLKKPLIWCMSFILVLTGPFMIYVYEP B2PIY4_ECO57 71 71 -
DKLGLKKPLIWCMSFILVLTGPFMIYVYEP B2P3E0_ECO57 71 71 -
DKLGLKKPLIWCMSFILVLTGPFMIYVYEP B2NM43_ECO57 71 71 -
DKLGPKKYLLWLIVILMVLFAPFFIYVYTP A9MER2_SALAR 122 122 -
DKLGLKKPLIWCMSFILVLTGPFMIYVYEP B3BZQ7_ECO57 71 71 -
DKLGLKKPLIWCMSFILVLTGPFMIYVYEP B7UG72_ECO27 71 71 -
DKLGLKKKILFMISCLLIFTGPFYIFVYGP A7Z937_BACA2 67 67 -
DRIGLKKHVLFFISCLLVFVGPFYIFVYGP Q8GM37_BACME 67 67 -
DKLGLKKNILFMISLLLVFTGPFYIFVYGP Q62NP8_BACLD 67 67 -
DKLGLKKNILFMISLLLVFTGPFYIFVYGP Q65D72_BACLD 69 69 -
DKLGLRKNLLWYIGVMLVISGPWFIFVCTP B6X3P1_9ENTR 71 71 -
DRLGLRKNLLWFLGGLLLISGPWFIFVCTP B6XE03_9ENTR 71 71 -
DKLVYRKNLMWMLAIIITLFAPYWIYVFAP B5Y2Z0_KLEP3 67 67 -
DRLDNRKHLIWCIVALLALLAPYMQWVFMP Q4J585_AZOVI 74 74 -
DKLVYRKNLMWMLAIIITLFAPYWIYVFAP A6THD0_KLEP7 35 35 -
DKLGLRKNLLWFLGFMLLMSGPFFVFVYAQ B2VEG9_ERWT9 68 68 -
DRLGLSRRLLVWIGVLLACAAPFAIHVYAG Q4J5B8_AZOVI 68 68 -
DKLGLRKNLLLVIAVLLILSGPFFLSFAAI B4ETB8_PROMH 68 68 -
DKLGLRKHLLLFVGVLLLLTGPFFIYVYAP A8GDJ6_SERP5 68 68 -
DRLGLSKKLLVWIGILLCAAAPFAIYVYAG Q4KBP0_PSEF5 68 68 -
DKLGLRKHLLWYITALLILSGPAYLLFGHL A6TDI9_KLEP7 69 69 -
DKLGLRKHLLWYITALLILSGPAYLLFGHL B5XUM4_KLEP3 69 69 -
DRLGLRKHLLWFITALLILSGPAYLLFSYL Q5I3L7_ECOLX 68 68 -
DKLGLRKNLLLFIAILLISSGPFFMVFGYL B2PZH0_PROST 68 68 -
DKLVFKKYLFAFVAILMLFMGPFFSYAYIP Q97IW0_CLOAB 67 67 -
DQLGIKRKLVIFISAVAALVGPFVQFVYAP B1S729_9BIFI 29 29 -
DQLGIKRKLVIFVSAIAALVGPFVQFVYAP B7GQ11_BIFLI 76 76 -
DQLGIKRKLVIFVSAIAALVGPFVQFVYAP B9AT88_BIFBR 78 78 -
DNLGLKRRLVLVISAIAALVGPFVQFVYAP B2EB37_BIFAN 71 71 -
DNLGLKRRLVLVISAIAALVGPFVQFVYAP Q84F23_BIFAN 71 71 -
DNLGLKRRLVLVISAIAALVGPFVQFVYAP Q564C6_BIFAN 71 71 -
DNLGLKRRLVLVISAIAALVGPFVQFVYAP B8DSY1_BIFAN 71 71 -
DQLGIKRKLVIFISAVAACVGPFVQFVYQP A1A2J7_BIFAA 106 106 -
DQLGIKRKLVIFISAVAACVGPFVQFVYQP A7A8U1_BIFAD 29 29 -
DQLGIKRKLVIVVSVIAACVGPFVQFVYAP B3DQ71_BIFLD 73 73 -
DQLGIKRKLVIVVSVIAACVGPFVQFVYAP Q8G7X9_BIFLO 128 128 -
DKLGMKKTMLKFFAVCQILVGPFFTWVYVP B7B2U4_9FIRM 72 72 -
DKIGMSKYLLYFVVAMSALMAPFFIYVYQP A4WEG3_ENT38 71 71 -
DKIGMSKYLLYFVVAMSALMAPFFIYVYQP B6FHW1_9ENTR 71 71 -
DKIGMSKYLLYFVVMMSALMAPFFIYVYQP A8APR2_CITK8 71 71 -
DRLGLRKDLLFFISLISITVFPFFFYIYKP A8AGB7_CITK8 74 74 -
DKMGMKKHLLYFVCIVSALMAPFYIWCYLP A8AJA2_CITK8 71 71 -

Motif 2 width=23
Element Seqn Id St Int Rpt
ILVGSIVGGIYLGFCFNAGAPAV A1A830_ECOK1 103 5 -
ILVGSIVGGIYLGFCFNAGAPAV Q8X4M4_ECO57 103 5 -
ILVGSIVGGIYLGFCFNAGAPAV Q8FKG7_ECOL6 103 5 -
ILVGSIVGGIYLGFCFNAGAPAV Q1RFJ3_ECOUT 103 5 -
ILVGSIVGGIYLGFCFNAGAPAV Q0TKT2_ECOL5 103 5 -
ILVGSIVGGIYLGFCFNAGAPAV LACY_ECOLI 103 5 -
ILVGSIVGGIYLGFCFNAGAPAV B8LFD7_ECOLI 81 5 -
ILVGSIVGGIYLGFCFNAGAPAV B7UJI8_ECO27 103 5 -
ILVGSIVGGIYLGFCFNAGAPAV B7N8Q0_ECOLU 103 5 -
ILVGSIVGGIYLGFCFNAGAPAV B7MPB0_ECO55 103 5 -
ILVGSIVGGIYLGFCFNAGAPAV B7MD16_ECO45 103 5 -
ILVGSIVGGIYLGFCFNAGAPAV B7L4Z9_ECO55 103 5 -
ILVGSIVGGIYLGFCFNAGAPAV B6ZQV6_ECO57 103 5 -
ILVGSIVGGIYLGFCFNAGAPAV B6HZW9_ECOSE 103 5 -
ILVGSIVGGIYLGFCFNAGAPAV B5Z2P6_ECO5E 103 5 -
ILVGSIVGGIYLGFCFNAGAPAV B3XFD5_ECOLX 103 5 -
ILVGSIVGGIYLGFCFNAGAPAV B3WLC9_ECOLX 103 5 -
ILVGSIVGGIYLGFCFNAGAPAV B3I6X4_ECOLX 103 5 -
ILVGSIVGGIYLGFCFNAGAPAV B3HW85_ECOLX 103 5 -
ILVGSIVGGIYLGFCFNAGAPAV B3H9P2_ECOLX 103 5 -
ILVGSIVGGIYLGFCFNAGAPAV B3BX93_ECO57 103 5 -
ILVGSIVGGIYLGFCFNAGAPAV B3BKY7_ECO57 103 5 -
ILVGSIVGGIYLGFCFNAGAPAV B3B2R6_ECO57 103 5 -
ILVGSIVGGIYLGFCFNAGAPAV B3AQR7_ECO57 103 5 -
ILVGSIVGGIYLGFCFNAGAPAV B3A810_ECO57 103 5 -
ILVGSIVGGIYLGFCFNAGAPAV B2PPQ5_ECO57 103 5 -
ILVGSIVGGIYLGFCFNAGAPAV B2P5K4_ECO57 103 5 -
ILVGSIVGGIYLGFCFNAGAPAV B2NT36_ECO57 103 5 -
ILVGSIVGGIYLGFCFNAGAPAV B1XBJ1_ECODH 103 5 -
ILVGSIVGGIYLGFCFNAGAPAV B1LIM8_ECOSM 103 5 -
ILVGSIVGGIYLGFCFNAGAPAV B1J0T6_ECOLC 103 5 -
ILVGSIVGGIYLGFCFNAGAPAV A7ZWZ0_ECOHS 103 5 -
ILVGSIVGGIYLGFCFNAGAPAV A7ZI90_ECO24 103 5 -
ILVGSIVGGIYLGFCFNAGAPAV A7KGA6_KLEPN 103 5 -
ILVGSIVGGIYLGFCFNAGAPAV A6TI28_KLEP7 103 5 -
ILVGSIVGGIYLGFCFNAGAPAV B7M2Z1_ECO8A 103 5 -
ILVGSIVGGIYLGFCFNAGAPAV B7NK12_ECO7I 103 5 -
ILLGSIVGGIYLGFIYNAGAPAI A9MQ81_SALAR 103 5 -
ILLGSIVGGIYLGFIYNAGAPAI LACY_CITFR 103 5 -
IFIGAIVGGCYLGFVFTGGSHAI A4TKH0_YERPP 110 5 -
IFIGAIVGGCYLGFVFTGGSHAI Q8D088_YERPE 89 5 -
IFIGAIVGGCYLGFVFTGGSHAI Q74V62_YERPE 110 5 -
IFIGAIVGGCYLGFVFTGGSHAI Q66C07_YERPS 110 5 -
IFIGAIVGGCYLGFVFTGGSHAI Q1CH05_YERPN 81 5 -
IFIGAIVGGCYLGFVFTGGSHAI Q1C9M5_YERPA 81 5 -
IFIGAIVGGCYLGFVFTGGSHAI B2JZT5_YERPB 110 5 -
IFIGAIVGGCYLGFVFTGGSHAI B1JPS6_YERPY 110 5 -
IFIGAIVGGCYLGFVFTGGSHAI B0HZV4_YERPE 81 5 -
IFIGAIVGGCYLGFVFTGGSHAI B0HG07_YERPE 81 5 -
IFIGAIVGGCYLGFVFTGGSHAI B0HBS1_YERPE 81 5 -
IFIGAIVGGCYLGFVFTGGSHAI B0GWG6_YERPE 81 5 -
IFIGAIVGGCYLGFVFTGGSHAI B0GG82_YERPE 81 5 -
IFIGAIVGGCYLGFVFTGGSHAI A9ZTX2_YERPE 81 5 -
IFIGAIVGGCYLGFVFTGGSHAI A9ZF02_YERPE 81 5 -
IFIGAIVGGCYLGFVFTGGSHAI A9R608_YERPG 110 5 -
IFIGAIVGGCYLGFVFTGGSHAI A7FJD5_YERP3 110 5 -
IVLGSIVGGIYLGFINNGGAPAI Q6D737_ERWCT 103 5 -
IWLGALMGGLYIGFCFSSGAGAI A7ML49_ENTS8 108 5 -
IWLGALSGGLYIGFVFSAGSGAI P96517 108 5 -
IWAGALTGGVFIGFVFSAGAGAI RAFB_ECOLI 106 5 -
IIAGSLVGGIYLGIVFSSGSGAV A6T8W9_KLEP7 110 5 -
IMAGALVGGVYLGIVFSSRSGAV LACY_KLEPN 108 5 -
IIAGALAGGIYLGIVFSSGSGAV B5XQY3_KLEP3 108 5 -
IWVGAFVGGCYLGIVFSSGSGAV A7MN75_ENTS8 108 5 -
IWLGALSGGLYIGFVFSAGSGAI A4WGA1_ENT38 108 5 -
IWAGALTGGVFIGFVFSAGAGAI B1VC73_ECOLX 106 5 -
IWAGALTGGVFIGFVFSAGAGAI B3X2I6_SHIDY 106 5 -
IWAGALTGGVFIGFVFSAGAGAI A7ZRF1_ECO24 111 5 -
IWAGALTGGVFIGFVFSAGAGAI B1LDI0_ECOSM 106 5 -
IWLGALSGGAYIGFVFSAGAGAM A6TG99_KLEP7 108 5 -
IWLGALSGGAYIGFVFSAGAGAM B5XZ61_KLEP3 108 5 -
FVLGALLCGIYLGLVCSGGSPAI A8GGG2_SERP5 103 5 -
VILGALVGGLYIGFSFSAGAGAI Q6D966_ERWCT 108 5 -
IWLGSIIGGAYIGFVFQAGTPAS A6VP59_ACTSZ 111 5 -
VWLGSLVGGAYIGFVFQAGAPAS Q65UE6_MANSM 119 5 -
FSVGLILGALFFGLGYLAGCGLL A7ZPG6_ECO24 106 5 -
FSVGLILGALFFGLGYLAGCGLL Q8XCL1_ECO57 106 5 -
FSVGLILGALFFGLGYLAGCGLL Q7WZY9_ECOLX 106 5 -
FSVGLILGALFFGLGYLAGCGLL Q3YZH1_SHISS 106 5 -
FSVGLILGALFFGLGYLAGCGLL Q0TFA0_ECOL5 106 5 -
FSVGLILGALFFGLGYLAGCGLL CSCB_ECOLI 106 5 -
FSVGLILGALFFGLGYLAGCGLL B7N5W1_ECOLU 106 5 -
FSVGLILGALFFGLGYLAGCGLL B7M6N0_ECO8A 106 5 -
FSVGLILGALFFGLGYLAGCGLL B7LBR4_ECO55 106 5 -
FSVGLILGALFFGLGYLAGCGLL B6ZXA4_ECO57 106 5 -
FSVGLILGALFFGLGYLAGCGLL B6I6R2_ECOSE 106 5 -
FSVGLILGALFFGLGYLAGCGLL B3WP35_ECOLX 106 5 -
FSVGLILGALFFGLGYLAGCGLL B3IM37_ECOLX 106 5 -
FSVGLILGALFFGLGYLAGCGLL B3I1M8_ECOLX 106 5 -
FSVGLILGALFFGLGYLAGCGLL B3HWW5_ECOLX 106 5 -
FSVGLILGALFFGLGYLAGCGLL B3H951_ECOLX 106 5 -
FSVGLILGALFFGLGYLAGCGLL B3BHI4_ECO57 106 5 -
FSVGLILGALFFGLGYLAGCGLL B3B6I8_ECO57 106 5 -
FSVGLILGALFFGLGYLAGCGLL B3ATT0_ECO57 106 5 -
FSVGLILGALFFGLGYLAGCGLL B3ABN9_ECO57 106 5 -
FSVGLILGALFFGLGYLAGCGLL B2PIY4_ECO57 106 5 -
FSVGLILGALFFGLGYLAGCGLL B2P3E0_ECO57 106 5 -
FSVGLILGALFFGLGYLAGCGLL B2NM43_ECO57 106 5 -
FAIGLVAGGLYLGFIFHAGYGAV A9MER2_SALAR 157 5 -
FSVGLILGALFFGLGYLAGCGLL B3BZQ7_ECO57 106 5 -
FSAGLILGALFFGLGYLAGCGLL B7UG72_ECO27 106 5 -
VFLGAVVGGLYLGAAFLAGIGAI A7Z937_BACA2 102 5 -
VVIGAIIGGLYLGVAFLAGIGAI Q8GM37_BACME 102 5 -
VFLGAIVGGIYLGTAFLAGIGAI Q62NP8_BACLD 102 5 -
VFLGAIVGGIYLGTAFLAGIGAI Q65D72_BACLD 104 5 -
IFLGSISLGVYVGATFFAGIGAL B6X3P1_9ENTR 106 5 -
IFAGAAALGIYVGATFFAGIGAL B6XE03_9ENTR 106 5 -
VFLGALAGGLYIGMAYGAGCGVC B5Y2Z0_KLEP3 102 5 -
LLVGVLAGGLYLGIIFAAGAGTL Q4J585_AZOVI 109 5 -
VFFGALAGGLYIGMAYGAGCGIC A6THD0_KLEP7 70 5 -
ILLGALAGGLYVGATFFAGTGAL B2VEG9_ERWT9 103 5 -
VVLGALVGAAFLAFAMLAGVGVI Q4J5B8_AZOVI 103 5 -
IFIGSILGGLYVGMTFNAGIGVL B4ETB8_PROMH 102 4 -
LVVGALVGGVFVSLAFNAGIGAL A8GDJ6_SERP5 103 5 -
VMLGALVGAAFLALAMLAGVGVI Q4KBP0_PSEF5 103 5 -
VLLGSIFGGIYIGLTFNGGIGVL A6TDI9_KLEP7 103 4 -
VLLGSIFGGIYIGLTFNGGIGVL B5XUM4_KLEP3 103 4 -
ILLGSVFGGLFIGLTFNGGIGVL Q5I3L7_ECOLX 102 4 -
VVVGSLIGGLFIGMTFHAGIGVL B2PZH0_PROST 102 4 -
IYVGAIIGSVYLSACFYAGVGVV Q97IW0_CLOAB 102 5 -
RYAGVLIGSIVLSAGFMAGCSLF B1S729_9BIFI 67 8 -
RFIGVLIGSIVLSSGFMAGCSLF B7GQ11_BIFLI 114 8 -
RFIGVLIGSIVLSSGFMAGCSLF B9AT88_BIFBR 116 8 -
MMAAALVGSVVLSAGFMAGCSLI B2EB37_BIFAN 106 5 -
MMAAALVGSVVLSAGFMAGCSLI Q84F23_BIFAN 106 5 -
MMAAALVGSVVLSAGFMAGCSLI Q564C6_BIFAN 106 5 -
MMAAALVGSVVLSAGFMAGCSLI B8DSY1_BIFAN 106 5 -
RFIGVLLGSIVLSAGFMAGCSLF A1A2J7_BIFAA 144 8 -
RFIGVLLGSIVLSAGFMAGCSLF A7A8U1_BIFAD 67 8 -
RWIGALIGSIVLSAGFMSGCSLF B3DQ71_BIFLD 111 8 -
RWIGALIGSIVLSAGFMSGCSLF Q8G7X9_BIFLO 166 8 -
FYVGAVVGAVYLAVAFLAACPVF B7B2U4_9FIRM 107 5 -
TMLGIIIGALYLSFAWYAGVAAC A4WEG3_ENT38 106 5 -
TMLGIIIGALYLSFAWYAGVAAC B6FHW1_9ENTR 106 5 -
TMLGIVIGAIYLSFAWYAGVAAC A8APR2_CITK8 106 5 -
LYAGIALGGIFLSMGYYAGCAAA A8AGB7_CITK8 109 5 -
FVSGMIVGALFFSLGWYAGVAAE A8AJA2_CITK8 106 5 -

Motif 3 width=19
Element Seqn Id St Int Rpt
MFGCVGWALCASIVGIMFT A1A830_ECOK1 145 19 -
MFGCVGWALCASIVGIMFT Q8X4M4_ECO57 145 19 -
MFGCVGWALCASIVGIMFT Q8FKG7_ECOL6 145 19 -
MFGCVGWALCASIVGIMFT Q1RFJ3_ECOUT 145 19 -
MFGCVGWALCASIVGIMFT Q0TKT2_ECOL5 145 19 -
MFGCVGWALCASIVGIMFT LACY_ECOLI 145 19 -
MFGCVGWALCASIVGIMFT B8LFD7_ECOLI 123 19 -
MFGCVGWALCASIVGIMFT B7UJI8_ECO27 145 19 -
MFGCVGWALCASIVGIMFT B7N8Q0_ECOLU 145 19 -
MFGCVGWALCASIVGIMFT B7MPB0_ECO55 145 19 -
MFGCVGWALCASIVGIMFT B7MD16_ECO45 145 19 -
MFGCVGWALCASIVGIMFT B7L4Z9_ECO55 145 19 -
MFGCVGWALCASIVGIMFT B6ZQV6_ECO57 145 19 -
MFGCVGWALCASIVGIMFT B6HZW9_ECOSE 145 19 -
MFGCVGWALCASIVGIMFT B5Z2P6_ECO5E 145 19 -
MFGCVGWALCASIVGIMFT B3XFD5_ECOLX 145 19 -
MFGCVGWALCASIVGIMFT B3WLC9_ECOLX 145 19 -
MFGCVGWALCASIVGIMFT B3I6X4_ECOLX 145 19 -
MFGCVGWALCASIVGIMFT B3HW85_ECOLX 145 19 -
MFGCVGWALCASIVGIMFT B3H9P2_ECOLX 145 19 -
MFGCVGWALCASIVGIMFT B3BX93_ECO57 145 19 -
MFGCVGWALCASIVGIMFT B3BKY7_ECO57 145 19 -
MFGCVGWALCASIVGIMFT B3B2R6_ECO57 145 19 -
MFGCVGWALCASIVGIMFT B3AQR7_ECO57 145 19 -
MFGCVGWALCASIVGIMFT B3A810_ECO57 145 19 -
MFGCVGWALCASIVGIMFT B2PPQ5_ECO57 145 19 -
MFGCVGWALCASIVGIMFT B2P5K4_ECO57 145 19 -
MFGCVGWALCASIVGIMFT B2NT36_ECO57 145 19 -
MFGCVGWALCASIVGIMFT B1XBJ1_ECODH 145 19 -
MFGCVGWALCASIVGIMFT B1LIM8_ECOSM 145 19 -
MFGCVGWALCASIVGIMFT B1J0T6_ECOLC 145 19 -
MFGCVGWALCASIVGIMFT A7ZWZ0_ECOHS 145 19 -
MFGCVGWALCASIVGIMFT A7ZI90_ECO24 145 19 -
MFGCVGWALCASIVGIMFT A7KGA6_KLEPN 145 19 -
MFGCVGWALCASIVGIMFT A6TI28_KLEP7 145 19 -
MFGCVGWALCASIVGIMFT B7M2Z1_ECO8A 145 19 -
MFGCVGWALCASIVSIMFT B7NK12_ECO7I 145 19 -
MFGCGGWALCASIVGVMFT A9MQ81_SALAR 145 19 -
MFGCVGWALCASIAGIMFT LACY_CITFR 145 19 -
MFGCIGWALCATVVGILYT A4TKH0_YERPP 152 19 -
MFGCIGWALCATVVGILYT Q8D088_YERPE 131 19 -
MFGCIGWALCATVVGILYT Q74V62_YERPE 152 19 -
MFGCIGWALCATVVGILYT Q66C07_YERPS 152 19 -
MFGCIGWALCATVVGILYT Q1CH05_YERPN 123 19 -
MFGCIGWALCATVVGILYT Q1C9M5_YERPA 123 19 -
MFGCIGWALCATVVGILYT B2JZT5_YERPB 152 19 -
MFGCIGWALCATVVGILYT B1JPS6_YERPY 152 19 -
MFGCIGWALCATVVGILYT B0HZV4_YERPE 123 19 -
MFGCIGWALCATVVGILYT B0HG07_YERPE 123 19 -
MFGCIGWALCATVVGILYT B0HBS1_YERPE 123 19 -
MFGCIGWALCATVVGILYT B0GWG6_YERPE 123 19 -
MFGCIGWALCATVVGILYT B0GG82_YERPE 123 19 -
MFGCIGWALCATVVGILYT A9ZTX2_YERPE 123 19 -
MFGCIGWALCATVVGILYT A9ZF02_YERPE 123 19 -
MFGCIGWALCATVVGILYT A9R608_YERPG 152 19 -
MFGCIGWALCATVVGILYT A7FJD5_YERP3 152 19 -
LFGCLGWALCASIVGIMFT Q6D737_ERWCT 145 19 -
MFGCLGWGLCASTAGMLFN A7ML49_ENTS8 150 19 -
MFGCLGWGLCASTGGILFG P96517 150 19 -
MFGCLGWALCATMAGILFN RAFB_ECOLI 148 19 -
VAGCVGWALCASITGVLFG A6T8W9_KLEP7 152 19 -
VSGCVGWALCASITGILFS LACY_KLEPN 150 19 -
VAGCVGWALCASITGVLFG B5XQY3_KLEP3 150 19 -
VSGCVGWALCASMTGMLFG A7MN75_ENTS8 150 19 -
MFGCLGWGLCASTGGVLFS A4WGA1_ENT38 150 19 -
MFGCLGWALCATMAGMLFN B1VC73_ECOLX 148 19 -
MFGCLGWALCATMAGMLFN B3X2I6_SHIDY 148 19 -
MFGCLGWALCAAMAGMLFN A7ZRF1_ECO24 153 19 -
MFGCLGWALCAAMAGMLFN B1LDI0_ECOSM 148 19 -
TFGCLGWALCATTAGMLFS A6TG99_KLEP7 150 19 -
TFGCLGWALCATTAGMLFS B5XZ61_KLEP3 150 19 -
LFGCIGWAICASIVGYMFT A8GGG2_SERP5 145 19 -
MFGCFGWGICASTAGMLFN Q6D966_ERWCT 150 19 -
MFGMFGWAICASIAGNLYG A6VP59_ACTSZ 153 19 -
MFGMFGWAICASIAGVLYA Q65UE6_MANSM 161 19 -
AWGSFGYAIGAFFAGIFFS A7ZPG6_ECO24 148 19 -
AWGSFGYAIGAFFAGIFFS Q8XCL1_ECO57 148 19 -
AWGSFGYAIGAFFAGIFFS Q7WZY9_ECOLX 148 19 -
AWGSFGYAIGAFFAGIFFS Q3YZH1_SHISS 148 19 -
AWGSFGYAIGAFFAGIFFS Q0TFA0_ECOL5 148 19 -
AWGSFGYAIGAFFAGIFFS CSCB_ECOLI 148 19 -
AWGSFGYAIGAFFAGIFFS B7N5W1_ECOLU 148 19 -
AWGSFGYAIGAFFAGIFFS B7M6N0_ECO8A 148 19 -
AWGSFGYAIGAFFAGIFFS B7LBR4_ECO55 148 19 -
AWGSFGYAIGAFFAGIFFS B6ZXA4_ECO57 148 19 -
AWGSFGYAIGAFFAGIFFS B6I6R2_ECOSE 148 19 -
AWGSFGYAIGAFFAGIFFS B3WP35_ECOLX 148 19 -
AWGSFGYAIGAFFAGIFFS B3IM37_ECOLX 148 19 -
AWGSFGYAIGAFFAGIFFS B3I1M8_ECOLX 148 19 -
AWGSFGYAIGAFFAGIFFS B3HWW5_ECOLX 148 19 -
AWGSFGYAIGAFFAGIFFS B3H951_ECOLX 148 19 -
AWGSFGYAIGAFFAGIFFS B3BHI4_ECO57 148 19 -
AWGSFGYAIGAFFAGIFFS B3B6I8_ECO57 148 19 -
AWGSFGYAIGAFFAGIFFS B3ATT0_ECO57 148 19 -
AWGSFGYAIGAFFAGIFFS B3ABN9_ECO57 148 19 -
AWGSFGYAIGAFFAGIFFS B2PIY4_ECO57 148 19 -
AWGSFGYAIGAFFAGIFFS B2P3E0_ECO57 148 19 -
AWGSFGYAIGAFFAGIFFS B2NM43_ECO57 148 19 -
LFGCFGSAACATISGILYG A9MER2_SALAR 199 19 -
AWGSFGYAIGAFFAGIFFS B3BZQ7_ECO57 148 19 -
AWGSFGYAIGAFFAGIFFS B7UG72_ECO27 148 19 -
MWGSLGWAAAAFFAGQLFN A7Z937_BACA2 144 19 -
MWGSLGWAAATFFAGQLFN Q8GM37_BACME 144 19 -
MWGSLGWAAATFFAGQLFN Q62NP8_BACLD 144 19 -
MWGSLGWAAATFFAGQLFN Q65D72_BACLD 146 19 -
MWGSLGWAGATFFAGILFN B6X3P1_9ENTR 148 19 -
MWGSLGWAGATFFAGLLFN B6XE03_9ENTR 148 19 -
MFGGIGAAIGTFAAGKLYG B5Y2Z0_KLEP3 144 19 -
MFGAIGYGSSAALSGMLVS Q4J585_AZOVI 151 19 -
MFGGIGAAIGTFAAGKLYG A6THD0_KLEP7 112 19 -
MWGSLGWASATFFAGMLLN B2VEG9_ERWT9 145 19 -
MWGSLGWAAATGVAGVVFD Q4J5B8_AZOVI 145 19 -
MWGSLGWASATFIAGHNIN B4ETB8_PROMH 144 19 -
MWGSLGWASATFFAGFNYN A8GDJ6_SERP5 145 19 -
MWGSLGWASATGVVGVVFN Q4KBP0_PSEF5 145 19 -
MWGSLGWAVATFFAGLLFN A6TDI9_KLEP7 145 19 -
MWGSLGWAVATFFAGLLFN B5XUM4_KLEP3 145 19 -
MWGSLGWAVATFFAGLLFN Q5I3L7_ECOLX 144 19 -
MWGSLGWAIATFFAGRNIN B2PZH0_PROST 144 19 -
LFGSIAGATASFVGGILYI Q97IW0_CLOAB 144 19 -
AWGSFGYAIVALCAGFLFN B1S729_9BIFI 109 19 -
AWGSFGYAIVALCAGFLFN B7GQ11_BIFLI 156 19 -
AWGSFGYAIVALCAGFLFN B9AT88_BIFBR 158 19 -
AWGSFGYAIVALVAGFVFN B2EB37_BIFAN 148 19 -
AWGSFGYAIVALVAGFVFN Q84F23_BIFAN 148 19 -
AWGSFGYAIVALVAGFVFN Q564C6_BIFAN 148 19 -
AWGSFGYAIVALVAGFVFN B8DSY1_BIFAN 148 19 -
AWGSFGYAVVALCAGFLFN A1A2J7_BIFAA 186 19 -
AWGSFGYAVVALCAGFLFN A7A8U1_BIFAD 109 19 -
AWGSFGYAIVALCAGFLFN B3DQ71_BIFLD 153 19 -
AWGSFGYAIVALCAGFLFN Q8G7X9_BIFLO 208 19 -
AWGSFGYAVAALCAGFLFT B7B2U4_9FIRM 149 19 -
MWGSLGWAVASSFSGLLFN A4WEG3_ENT38 148 19 -
MWGSLGWAVASSFSGLLFN B6FHW1_9ENTR 148 19 -
MWGSLGWAVASSFSGLLFN A8APR2_CITK8 148 19 -
MWGAIGSVFSAASTGYIFN A8AGB7_CITK8 151 19 -
MWAALGWATASSFSGYLYN A8AJA2_CITK8 148 19 -

Motif 4 width=29
Element Seqn Id St Int Rpt
LELFRQPKLWFLSLYVIGVSCTYDVFDQQ A1A830_ECOK1 214 50 -
LELFRQPKLWFLSLYVIGVSCTYDVFDQQ Q8X4M4_ECO57 214 50 -
LELFRQPKLWFLSLYVIGVSCTYDVFDQQ Q8FKG7_ECOL6 214 50 -
LELFRQPKLWFLSLYVIGVSCTYDVFDQQ Q1RFJ3_ECOUT 214 50 -
LELFRQPKLWFLSLYVIGVSCTYDVFDQQ Q0TKT2_ECOL5 214 50 -
LELFRQPKLWFLSLYVIGVSCTYDVFDQQ LACY_ECOLI 214 50 -
LELFRQPKLWFLSLYVIGVSCTYDVFDQQ B8LFD7_ECOLI 192 50 -
LELFRQPKLWFLSLYVIGVSCTYDVFDQQ B7UJI8_ECO27 214 50 -
LELFRQPKLWFLSLYVIGVSCTYDVFDQQ B7N8Q0_ECOLU 214 50 -
LELFRQPKLWFLSLYVIGVSCTYDVFDQQ B7MPB0_ECO55 214 50 -
LELFRQPKLWFLSLYVIGVSCTYDVFDQQ B7MD16_ECO45 214 50 -
LELFRQPKLWFLSLYVIGVSCTYDVFDQQ B7L4Z9_ECO55 214 50 -
LELFRQPKLWFLSLYVIGVSCTYDVFDQQ B6ZQV6_ECO57 214 50 -
LELFRQPKLWFLSLYVIGVSCTYDVFDQQ B6HZW9_ECOSE 214 50 -
LELFRQPKLWFLSLYVIGVSCTYDVFDQQ B5Z2P6_ECO5E 214 50 -
LELFRQPKLWFLSLYVIGVSCTYDVFDQQ B3XFD5_ECOLX 214 50 -
LELFRQPKLWFLSLYVIGVSCTYDVFDQQ B3WLC9_ECOLX 214 50 -
LELFRQPKLWFLSLYVIGVSCTYDVFDQQ B3I6X4_ECOLX 214 50 -
LELFRQPKLWFLSLYVIGVSCTYDVFDQQ B3HW85_ECOLX 214 50 -
LELFRQPKLWFLSLYVIGVSCTYDVFDQQ B3H9P2_ECOLX 214 50 -
LELFRQPKLWFLSLYVIGVSCTYDVFDQQ B3BX93_ECO57 214 50 -
LELFRQPKLWFLSLYVIGVSCTYDVFDQQ B3BKY7_ECO57 214 50 -
LELFRQPKLWFLSLYVIGVSCTYDVFDQQ B3B2R6_ECO57 214 50 -
LELFRQPKLWFLSLYVIGVSCTYDVFDQQ B3AQR7_ECO57 214 50 -
LELFRQPKLWFLSLYVIGVSCTYDVFDQQ B3A810_ECO57 214 50 -
LELFRQPKLWFLSLYVIGVSCTYDVFDQQ B2PPQ5_ECO57 214 50 -
LELFRQPKLWFLSLYVIGVSCTYDVFDQQ B2P5K4_ECO57 214 50 -
LELFRQPKLWFLSLYVIGVSCTYDVFDQQ B2NT36_ECO57 214 50 -
LELFRQPKLWFLSLYVIGVSCTYDVFDQQ B1XBJ1_ECODH 214 50 -
LELFRQPKLWFLSLYVIGVSCTYDVFDQQ B1LIM8_ECOSM 214 50 -
LELFRQPKLWFLSLYVIGVSCTYDVFDQQ B1J0T6_ECOLC 214 50 -
LELFRQPKLWFLSLYVIGVSCTYDVFDQQ A7ZWZ0_ECOHS 214 50 -
LELFRQPKLWFLSLYVIGVSCTYDVFDQQ A7ZI90_ECO24 214 50 -
LELFRQPKLWFLSLYVIGVSCTYDVFDQQ A7KGA6_KLEPN 214 50 -
LELFRQPKLWFLSLYVIGVSCTYDVFDQQ A6TI28_KLEP7 214 50 -
LELFRQPKLWFLSLYVIGVSCTYDVFDQQ B7M2Z1_ECO8A 214 50 -
LELFRQPKLWFLSLYVIGVSCTYDVFDQQ B7NK12_ECO7I 214 50 -
LELFKQPKLWFLSLYVVGVSCTYDVFDQQ A9MQ81_SALAR 214 50 -
LELFKQPKLWLISLYVVGVSCTYDVFDQQ LACY_CITFR 214 50 -
LALLRKRELWFFVMYIVGVACIYDVFDQQ A4TKH0_YERPP 221 50 -
LALLRKRELWFFVMYIVGVACIYDVFDQQ Q8D088_YERPE 200 50 -
LALLRKRELWFFVMYIVGVACIYDVFDQQ Q74V62_YERPE 221 50 -
LALLRKRELWFFVMYIVGVACIYDVFDQQ Q66C07_YERPS 221 50 -
LALLRKRELWFFVMYIVGVACIYDVFDQQ Q1CH05_YERPN 192 50 -
LALLRKRELWFFVMYIVGVACIYDVFDQQ Q1C9M5_YERPA 192 50 -
LALLRKRELWFFVMYIVGVACIYDVFDQQ B2JZT5_YERPB 221 50 -
LALLRKRELWFFVMYIVGVACIYDVFDQQ B1JPS6_YERPY 221 50 -
LALLRKRELWFFVMYIVGVACIYDVFDQQ B0HZV4_YERPE 192 50 -
LALLRKRELWFFVMYIVGVACIYDVFDQQ B0HG07_YERPE 192 50 -
LALLRKRELWFFVMYIVGVACIYDVFDQQ B0HBS1_YERPE 192 50 -
LALLRKRELWFFVMYIVGVACIYDVFDQQ B0GWG6_YERPE 192 50 -
LALLRKRELWFFVMYIVGVACIYDVFDQQ B0GG82_YERPE 192 50 -
LALLRKRELWFFVMYIVGVACIYDVFDQQ A9ZTX2_YERPE 192 50 -
LALLRKRELWFFVMYIVGVACIYDVFDQQ A9ZF02_YERPE 192 50 -
LALLRKRELWFFVMYIVGVACIYDVFDQQ A9R608_YERPG 221 50 -
LALLRKRELWFFVMYIVGVACIYDVFDQQ A7FJD5_YERP3 221 50 -
VELLKERKIWFLTLYVVGVSCTYDVFDQQ Q6D737_ERWCT 214 50 -
LGLFRLPKLWMFILYVVGVACVYDVFDQQ A7ML49_ENTS8 219 50 -
FNLFRQRRMWMFILYVIGVACVYDVFDQQ P96517 219 50 -
FSLFRMRQMWMFVLYTIGVACVYDVFDQQ RAFB_ECOLI 217 50 -
AELLRMPRFWGFIVYVVGVASVYDVFDQQ A6T8W9_KLEP7 221 50 -
AELFRMPRFWGFIIYVVGVASVYDVFDQQ LACY_KLEPN 219 50 -
AELLRMPRFWGFIVYVIGVASVYDVFDQQ B5XQY3_KLEP3 219 50 -
SELFRMRSFWAFIIYVVGVASVYDVFDQQ A7MN75_ENTS8 218 49 -
ISLFRQRRMWMFILYVIGVACVYDVFDQQ A4WGA1_ENT38 219 50 -
FSLFRMRQMWMFVLYTIGVACVYDVFDQQ B1VC73_ECOLX 217 50 -
FSLFRMRQMWMFVLYTIGVACVYDVFDQQ B3X2I6_SHIDY 217 50 -
FSLFRMRQMWMFVLYTIGVACVYDVFDQQ A7ZRF1_ECO24 222 50 -
FSLFRMRQMWMFVLYTIGVACVYDVFDQQ B1LDI0_ECOSM 217 50 -
VRMFRQRKMWMFILYVIGVACVYDVFDQQ A6TG99_KLEP7 219 50 -
VRMFRQRKMWMFILYVIGVACVYDVFDQQ B5XZ61_KLEP3 219 50 -
LSLLKMRKFWCLVMYIVGVACVYDVFDQQ A8GGG2_SERP5 214 50 -
LGLLANRQFWLLVLYVVGVACIYDVYDQQ Q6D966_ERWCT 219 50 -
VMIFKRPKFWALLAYVVGVACIYDIFDQQ A6VP59_ACTSZ 222 50 -
FALLKLPKFWALLAYVMGIACVYDIFDQQ Q65UE6_MANSM 230 50 -
IAVFKDRNFWVFVIFIVGTWSFYNIFDQQ