SPRINT Home UMBER Home Contents Standard Search Advanced Search Relation Search

==SPRINT==> PRINTS View



  selected as


PR00152

Identifier
RUBISCOSMALL  [View Relations]  [View Alignment]  
Accession
PR00152
No. of Motifs
6
Creation Date
10-OCT-1993  (UPDATE 28-JUN-1999)
Title
RuBisCO small subunit signature
Database References

PFAM; PF00101 RuBisCO_small
INTERPRO; IPR000894
Literature References
1. BROGLIE, R., CORUZZI, G., LAMPPA, G., KEITH, B. AND CHUA, N.H.
Structural analysis of nuclear genes coding for the precursor to the small
subunit of wheat ribulose-1,5-bisphosphate carboxylase.
BIOTECHNOLOGY 1(1) 55-61 (1983).
 
2. PICHERSKY, E., BERNATZKY, R., TANKSLEY, S.D. AND CASHMORE, A.R.
Evidence for selection as a mechanism in the concerted evolution of 
Lycopersicon esculentum (tomato) genes encoding the small subunit of
ribulose-1,5-bisphosphate carboxylase oxygenase.
PROC.NATL.ACAD.SCI.U.S.A. 83(11) 3880-3884 (1986).
 
3. TUMER, N.E., CLARK, W.G., TABOR, G.J., HIRONAKA, C.M., FRALEY, R.T.
AND SHAH, D.M.
The genes encoding the small subunit of ribulose-1,5-bisphosphate
carboxylase are expressed differently in petunia leaves.
NUCLEIC ACIDS RES. 14(8) 3325-3342 (1986).

Documentation
RuBisCO (ribulose-1,5-bisphosphate carboxylase/oxygenase) is a bifunctional
enzyme that catalyses both the carboxylation and oxygenation of ribulose-
1,5-bisphosphate (RuBP) [1], thus fixing carbon dioxide as the first step
of the Calvin cycle [2]. RuBisCO is the major protein in the stroma of
chloroplasts, and in higher plants exists as a complex of 8 large and 8
small subunits: the function of the small subunit is unknown [2]. While
the large subunit is coded for by a single gene, the small subunit is
coded for by several different genes, which are distributed in a tissue
specific manner - they are transcriptionally regulated by light receptor
phytochrome [3], which results in RuBisCO being more abundant during the
day when it is required. 
 
RUBISCOSMALL is a 6-element fingerprint that provides a signature for
RuBisCO small subunits. The fingerprint was derived from an initial
alignment of 12 sequences: the motifs were drawn from conserved regions
spanning virtually the full alignment length, motifs 1 and 2 comprising
part of the chloroplast localisation sequence. Three iterations on OWL21.1
were required to reach convergence, at which point a true set comprising
62 sequences was identified. Several partial matches was also found, all
of which are fragments.
 
An update on SPTR37_9f identified a true set of 93 sequences, and 12
partial matches.
Summary Information
  93 codes involving  6 elements
2 codes involving 5 elements
1 codes involving 4 elements
1 codes involving 3 elements
8 codes involving 2 elements
Composite Feature Index
6939393939393
5122212
4001111
3001011
2008053
123456
True Positives
O20253        O22487        O24574        O65105        
Q36688 Q39832 Q42815 Q43110
Q43115 Q43746 Q43874 RBS0_SOLTU
RBS1_ARATH RBS1_BRANA RBS1_FLAPR RBS1_FRIAG
RBS1_LEMGI RBS1_LYCES RBS1_MESCR RBS1_NICSY
RBS1_ORYSA RBS1_PETSP RBS1_SOLTU RBS1_SOYBN
RBS1_WHEAT RBS2_ARATH RBS2_BRANA RBS2_FLAPR
RBS2_FRIAG RBS2_LEMGI RBS2_LYCES RBS2_MESCR
RBS2_ORYSA RBS2_PEA RBS2_PETSP RBS2_SPIOL
RBS2_WHEAT RBS3_ARATH RBS3_FLAPR RBS3_FRIAG
RBS3_LEMGI RBS3_LYCES RBS3_MESCR RBS3_ORYSA
RBS3_PEA RBS3_SOLTU RBS4_ARATH RBS4_FLAPR
RBS4_LEMGI RBS4_LYCES RBS4_MESCR RBS4_SOYBN
RBS5_FLAPR RBS5_FRIAG RBS5_LEMGI RBS5_MESCR
RBS6_FLAPR RBS6_LEMGI RBS6_MESCR RBS7_FLAPR
RBS8_NICPL RBSA_SOLTU RBSB_SOLTU RBSC_SOLTU
RBS_AEGSQ RBS_AMAHP RBS_BETVE RBS_CAPAN
RBS_CUCSA RBS_FAGCR RBS_FLATR RBS_GLYTA
RBS_GLYTO RBS_GOSHI RBS_HELAN RBS_HEVBR
RBS_HORVU RBS_LACSA RBS_LARLA RBS_MAIZE
RBS_MALSP RBS_MANES RBS_MEDSA RBS_MUSAC
RBS_PINTH RBS_PYRPY RBS_RAPSA RBS_SACHY
RBS_SILPR RBS_STELP RBS_TOBAC RBS_TRIRP
RBS_ZANAE
True Positive Partials
Codes involving 5 elements
RBSX_TOBAC RBS_MARPA
Codes involving 4 elements
RBS1_SPIOL
Codes involving 3 elements
RBS_EUGGR
Codes involving 2 elements
Q59138 RBS3_ACECL RBS3_ACEME RBS4_ACECL
RBS5_ACECL RBS6_ACECL RBS_PROHO RBS_SYNY3
Sequence Titles
O20253      RIBULOSE 1,5-BISPHOSPHATE CARBOXYLASE SMALL SUBUNIT (EC 4.1.1.39) (RIBULOSE-BISPHOSPHATE CARBOXYLASE) (RIBULOSE BISPHOSPHATE CARBOXYLASE/OXYGENASE) (RUBISCO) - SPINACIA OLERACEA (SPINACH). 
O22487 RIBULOSE 1,5-BISPHOSPHATE CARBOXYLASE SMALL SUBUNIT - ORYZA SATIVA (RICE).
O24574 RUBISCO SMALL SUBUNIT - ZEA MAYS (MAIZE).
O65105 RIBULOSE 1,5-BISPHOSPHATE CARBOXYLASE SMALL SUBUNIT - ORYZA SATIVA (RICE).
Q36688 RIBULOSE 1,5-BISPHOSPHATE CARBOXYLASE - ORYZA SATIVA (RICE).
Q39832 RIBULOSE-1,5-BISPHOSPHATE CARBOXYLASE SMALL SUBUNIT PRECURSOR - GLYCINE MAX (SOYBEAN).
Q42815 RIBULOSE 1,5-BISPHOSPHATE CARBOXYLASE SMALL SUBUNIT PRECURSOR (EC 4.1.1.39) (RIBULOSE-BISPHOSPHATE CARBOXYLASE) (RIBULOSE BISPHOSPHATE CARBOXYLASE/OXYGENASE) (RUBISCO) - GLYCINE MAX (SOYBEAN).
Q43110 RIBULOSE-BISPHOSPHATE CARBOXYLASE PRECURSOR (EC 4.1.1.39) (RIBULOSE BISPHOSPHATE CARBOXYLASE/OXYGENASE) (RUBISCO) - PTERIS VITTATA (CHINESE BRAKE).
Q43115 RIBULOSE 1,5-BISPHOSPHATE CARBOXYLASE SMALL SUBUNIT PRECURSOR (EC 4.1.1.39) (RIBULOSE-BISPHOSPHATE CARBOXYLASE) (RIBULOSE BISPHOSPHATE CARBOXYLASE/OXYGENASE) (RUBISCO) - MALUS DOMESTICA X PYRUS COMMUNIS.
Q43746 RIBULOSE-BISPHOSPHATE CARBOXYLASE PRECURSOR (EC 4.1.1.39) (RIBULOSE BISPHOSPHATE CARBOXYLASE/OXYGENASE) (RUBISCO) - BRASSICA NAPUS (RAPE).
Q43874 RIBULOSE BISPHOSPHATE CARBOXYLASE PRECURSOR (EC 4.1.1.39) (RIBULOSE-BISPHOSPHATE CARBOXYLASE) (RIBULOSE BISPHOSPHATE CARBOXYLASE/OXYGENASE) (RUBISCO) - PHASEOLUS VULGARIS (KIDNEY BEAN) (FRENCH BEAN).
RBS0_SOLTU RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN C PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT C) - SOLANUM TUBEROSUM (POTATO).
RBS1_ARATH RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN 1A PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT 1A) - ARABIDOPSIS THALIANA (MOUSE-EAR CRESS).
RBS1_BRANA RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT) - BRASSICA NAPUS (RAPE).
RBS1_FLAPR RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN 1 PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT 1) - FLAVERIA PRINGLEI.
RBS1_FRIAG RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN 1/4 PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT 1/4) - FRITILLARIA AGRESTIS.
RBS1_LEMGI RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN SSU1 PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT SSU1) - LEMNA GIBBA (SWOLLEN DUCKWEED).
RBS1_LYCES RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN 1 PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT 1) (LESS17) - LYCOPERSICON ESCULENTUM (TOMATO).
RBS1_MESCR RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN 1 PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT 1) - MESEMBRYANTHEMUM CRYSTALLINUM (COMMON ICE PLANT).
RBS1_NICSY RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN S41 PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT S41) - NICOTIANA SYLVESTRIS (WOOD TOBACCO).
RBS1_ORYSA RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT) - ORYZA SATIVA (RICE).
RBS1_PETSP RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN SSU8 PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT SSU8) - PETUNIA SP. (PETUNIA).
RBS1_SOLTU RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN 1 PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT 1) - SOLANUM TUBEROSUM (POTATO).
RBS1_SOYBN RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN 1 PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT 1) - GLYCINE MAX (SOYBEAN).
RBS1_WHEAT RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN PWS4.3 PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT PWS4.3) - TRITICUM AESTIVUM (WHEAT).
RBS2_ARATH RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN 1B PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT 1B) - ARABIDOPSIS THALIANA (MOUSE-EAR CRESS).
RBS2_BRANA RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN F1 PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT F1) - BRASSICA NAPUS (RAPE).
RBS2_FLAPR RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN 2 PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT 2) - FLAVERIA PRINGLEI.
RBS2_FRIAG RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN 2 PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT 2) - FRITILLARIA AGRESTIS.
RBS2_LEMGI RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN SSU26 PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT SSU26) - LEMNA GIBBA (SWOLLEN DUCKWEED).
RBS2_LYCES RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN 2A PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT 2A) (LESS 5) - LYCOPERSICON ESCULENTUM (TOMATO).
RBS2_MESCR RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN 2 PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT 2) - MESEMBRYANTHEMUM CRYSTALLINUM (COMMON ICE PLANT).
RBS2_ORYSA RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN A PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT A) - ORYZA SATIVA (RICE).
RBS2_PEA RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN 3C PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT 3C) (PSS15) - PISUM SATIVUM (GARDEN PEA).
RBS2_PETSP RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN SSU11A PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT SSU11A) - PETUNIA SP. (PETUNIA).
RBS2_SPIOL RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN 2 PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT 2) - SPINACIA OLERACEA (SPINACH).
RBS2_WHEAT RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN PW9 PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT PW9) - TRITICUM AESTIVUM (WHEAT).
RBS3_ARATH RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN 2B PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT 2B) - ARABIDOPSIS THALIANA (MOUSE-EAR CRESS).
RBS3_FLAPR RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN 3 PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT 3) - FLAVERIA PRINGLEI.
RBS3_FRIAG RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN 3 PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT 3) - FRITILLARIA AGRESTIS.
RBS3_LEMGI RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN SSU40A PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT SSU40A) - LEMNA GIBBA (SWOLLEN DUCKWEED).
RBS3_LYCES RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN 3A/3C PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT 3A/3C) - LYCOPERSICON ESCULENTUM (TOMATO).
RBS3_MESCR RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN 3 PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT 3) - MESEMBRYANTHEMUM CRYSTALLINUM (COMMON ICE PLANT).
RBS3_ORYSA RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN C PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT C) - ORYZA SATIVA (RICE).
RBS3_PEA RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN 3A PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT 3A) - PISUM SATIVUM (GARDEN PEA).
RBS3_SOLTU RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN 3 PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT 3) - SOLANUM TUBEROSUM (POTATO).
RBS4_ARATH RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN 3B PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT 3B) - ARABIDOPSIS THALIANA (MOUSE-EAR CRESS).
RBS4_FLAPR RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN 4 PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT 4) - FLAVERIA PRINGLEI.
RBS4_LEMGI RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN SSU40B PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT SSU40B) - LEMNA GIBBA (SWOLLEN DUCKWEED).
RBS4_LYCES RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN 3B PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT 3B) - LYCOPERSICON ESCULENTUM (TOMATO).
RBS4_MESCR RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN 4 PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT 4) - MESEMBRYANTHEMUM CRYSTALLINUM (COMMON ICE PLANT).
RBS4_SOYBN RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN 4 PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT 4) - GLYCINE MAX (SOYBEAN).
RBS5_FLAPR RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN 5 PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT 5) - FLAVERIA PRINGLEI.
RBS5_FRIAG RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN 5 PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT 5) - FRITILLARIA AGRESTIS.
RBS5_LEMGI RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN SSU5A PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT SSU5A) - LEMNA GIBBA (SWOLLEN DUCKWEED).
RBS5_MESCR RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN 5 PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT 5) - MESEMBRYANTHEMUM CRYSTALLINUM (COMMON ICE PLANT).
RBS6_FLAPR RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN 6 PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT 6) - FLAVERIA PRINGLEI.
RBS6_LEMGI RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN SSU5B PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT SSU5B) - LEMNA GIBBA (SWOLLEN DUCKWEED).
RBS6_MESCR RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN 6 PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT 6) - MESEMBRYANTHEMUM CRYSTALLINUM (COMMON ICE PLANT).
RBS7_FLAPR RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN 7 PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT 7) - FLAVERIA PRINGLEI.
RBS8_NICPL RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN 8B PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT 8B) - NICOTIANA PLUMBAGINIFOLIA (LEADWORT-LEAVED TOBACCO).
RBSA_SOLTU RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN 2A PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT 2A) - SOLANUM TUBEROSUM (POTATO).
RBSB_SOLTU RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN 2B PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT 2B) - SOLANUM TUBEROSUM (POTATO).
RBSC_SOLTU RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN 2C PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT 2C) - SOLANUM TUBEROSUM (POTATO).
RBS_AEGSQ RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT) - AEGILOPS SQUARROSA.
RBS_AMAHP RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT) - AMARANTHUS HYPOCHONDRIACUS (PRINCE'S FEATHER).
RBS_BETVE RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT) - BETULA VERRUCOSA (WHITE BIRCH) (BETULA PENDULA).
RBS_CAPAN RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT) - CAPSICUM ANNUUM (BELL PEPPER).
RBS_CUCSA RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT) - CUCUMIS SATIVUS (CUCUMBER).
RBS_FAGCR RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT) - FAGUS CRENATA (JAPANESE BEECH).
RBS_FLATR RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT) - FLAVERIA TRINERVIA.
RBS_GLYTA RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT) - GLYCINE TABACINA.
RBS_GLYTO RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT) - GLYCINE TOMENTELLA.
RBS_GOSHI RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT) - GOSSYPIUM HIRSUTUM (UPLAND COTTON).
RBS_HELAN RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT) - HELIANTHUS ANNUUS (COMMON SUNFLOWER).
RBS_HEVBR RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT) - HEVEA BRASILIENSIS (PARA RUBBER TREE).
RBS_HORVU RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT) - HORDEUM VULGARE (BARLEY).
RBS_LACSA RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT) - LACTUCA SATIVA (GARDEN LETTUCE).
RBS_LARLA RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT) - LARIX LARICINA (TAMARACK) (AMERICAN LARCH).
RBS_MAIZE RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT) - ZEA MAYS (MAIZE).
RBS_MALSP RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT) - MALUS SP. (CRAB APPLE).
RBS_MANES RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT) - MANIHOT ESCULENTA (CASSAVA) (MANIOC).
RBS_MEDSA RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT) - MEDICAGO SATIVA (ALFALFA).
RBS_MUSAC RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT) - MUSA ACUMINATA (BANANA).
RBS_PINTH RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT) - PINUS THUNBERGII (GREEN PINE) (JAPANESE BLACK PINE).
RBS_PYRPY RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT) - PYRUS PYRIFOLIA (JAPANESE PEAR).
RBS_RAPSA RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT) - RAPHANUS SATIVUS (RADISH).
RBS_SACHY RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT) - SACCHARUM HYBRID (SUGARCANE).
RBS_SILPR RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT) - SILENE PRATENSIS (WHITE CAMPION) (LYCHNIS ALBA).
RBS_STELP RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT) - STELLARIA LONGIPES.
RBS_TOBAC RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT) - NICOTIANA TABACUM (COMMON TOBACCO), AND NICOTIANA SYLVESTRIS (WOOD TOBACCO).
RBS_TRIRP RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT) - TRIFOLIUM REPENS (CREEPING WHITE CLOVER).
RBS_ZANAE RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT) - ZANTEDESCHIA AETHIOPICA (WHITE CALLA LILY).

RBSX_TOBAC RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT) - NICOTIANA TABACUM (COMMON TOBACCO).
RBS_MARPA RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT) - MARCHANTIA PALEACEA.

RBS1_SPIOL RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT) - SPINACIA OLERACEA (SPINACH).

RBS_EUGGR RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAINS PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNITS) - EUGLENA GRACILIS.

Q59138 RIBULOSE 1,5-BISPHOSPHATE CARBOXYLASE/OXYGENASE SMALL SUBUNIT (EC 4.1.1.39) (RIBULOSE-BISPHOSPHATE CARBOXYLASE) (RIBULOSE BISPHOSPHATE CARBOXYLASE/OXYGENASE) (RUBISCO) - ANABAENA SP.
RBS3_ACECL RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN 3 PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT 3) - ACETABULARIA CLIFTONII.
RBS3_ACEME RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN 3 PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT 3) - ACETABULARIA MEDITERRANEA (MERMAID'S WINE GLASS).
RBS4_ACECL RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN 4 PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT 4) - ACETABULARIA CLIFTONII.
RBS5_ACECL RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN 5 PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT 5) - ACETABULARIA CLIFTONII.
RBS6_ACECL RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN 6 PRECURSOR (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT 6) - ACETABULARIA CLIFTONII.
RBS_PROHO RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT) - PROCHLOROTHRIX HOLLANDICA.
RBS_SYNY3 RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN (EC 4.1.1.39) (RUBISCO SMALL SUBUNIT) - SYNECHOCYSTIS SP. (STRAIN PCC 6803).
Scan History
OWL21_1    3  100  NSINGLE    
OWL26_0 1 125 NSINGLE
SPTR37_9f 3 110 NSINGLE
Initial Motifs
Motif 1  width=18
Element Seqn Id St Int Rpt
QASMVAPFTGLKSAASFP RBSA_SOLTU 19 19 -
QASMVAPFTGLKSAASFP RBS0_SOLTU 19 19 -
QANMVAPFTGLKSAASFP RBS_TOBAC 19 19 -
QASMVAPFTGLKSAASFP RBS1_LYCES 19 19 -
QANMVAPFTGLKSAASFP RBS8_NICPL 19 19 -
QASMVAPFNGLKSAVSFP RBS1_PETSP 19 19 -
GAGMVAPFTGLKSMAGLP RBS4_SOYBN 18 18 -
QATMVAPFTGLKSSASFP RBS2_ARATH 17 17 -
QTNMVAPFTGLKANAAFP RBS_FLATR 13 13 -
QSAAVAPFGGLKSMTGFP RBS3_PEA 20 20 -
QASMVAPFTGLKSSAGFP RBS_CUCSA 21 21 -
QSNMVAPFNGLRSSVAFP RBS2_LEMGI 19 19 -

Motif 2 width=19
Element Seqn Id St Int Rpt
TSIASNGGRVRCMQVWPPI RBSA_SOLTU 46 9 -
TSLASNGGRVRCMQVWPPI RBS0_SOLTU 47 10 -
TSIASNGGRVQCMQVWPPI RBS_TOBAC 46 9 -
TSLASNGGRVRCMQVWPPI RBS1_LYCES 47 10 -
TSIASNGGRVQCMQVWPPI RBS8_NICPL 46 9 -
TSIASNGGRVQCMQVWPPY RBS1_PETSP 46 9 -
TSIASNGGRVQCMQVWPPV RBS4_SOYBN 44 8 -
TSITSNGGRVSCMKVWPPI RBS2_ARATH 44 9 -
STLPSNGGRVQCMKVWPPV RBS_FLATR 39 8 -
TSITSNGGRVKCMQVWPPI RBS3_PEA 46 8 -
TTLASNAGKVQCMKVWPPL RBS_CUCSA 48 9 -
STLPSNGGKVSCMQVWPPE RBS2_LEMGI 46 9 -

Motif 3 width=27
Element Seqn Id St Int Rpt
KKYETLSYLPDLSDEQLLKEVEYLLKN RBSA_SOLTU 67 2 -
KKYETLSYLPDLSDEQLLKEVEYLLKN RBS0_SOLTU 68 2 -
KKYETLSYLPDLSQEQLLSEVEYLLKN RBS_TOBAC 67 2 -
KKYETLSYLPDLSDEQLLSEIEYLLKN RBS1_LYCES 68 2 -
KKYETLSYLPDLSQEQLLSEIEYLLKS RBS8_NICPL 67 2 -
KKYETLSYLPDLTDEQLLKEIEYLLNK RBS1_PETSP 67 2 -
KKFETLSYLPDLDDAQLAKEVEYLLRK RBS4_SOYBN 65 2 -
KKFETLSYLPDLTDVELAKEVDYLLRN RBS2_ARATH 65 2 -
KKYETLSYLPELTEAQLAKEVDYLLRN RBS_FLATR 60 2 -
KKFETLSYLPPLTRDQLLKEVEYLLRK RBS3_PEA 67 2 -
RKFETLSYLPDMSNEQLSKECDYLLRN RBS_CUCSA 69 2 -
KKFETLSYLPPLSVEDLAKEVDYLLRN RBS2_LEMGI 67 2 -

Motif 4 width=16
Element Seqn Id St Int Rpt
WVPCLEFETEHGFVYR RBSA_SOLTU 95 1 -
WVPCLEFETEHGFVYR RBS0_SOLTU 96 1 -
WVPCLEFETEHGFVYR RBS_TOBAC 95 1 -
WVPCLEFETERGFVYR RBS1_LYCES 96 1 -
WVPCLEFETERGFVYR RBS8_NICPL 95 1 -
WVPCLEFETEHGFVYR RBS1_PETSP 95 1 -
WIPCLEFELEHGFVYR RBS4_SOYBN 93 1 -
WIPCVEFELEHGFVYR RBS2_ARATH 93 1 -
WVPCLEFELEHGFVYR RBS_FLATR 88 1 -
WVPCLEFELEKGFVYR RBS3_PEA 95 1 -
WVPCVEFDIGSGFVYR RBS_CUCSA 97 1 -
WVPCIEFSKEGFVYRE RBS2_LEMGI 95 1 -

Motif 5 width=30
Element Seqn Id St Int Rpt
GYYDGRYWTMWKLPMFGCTDATQVLAEVEE RBSA_SOLTU 117 6 -
GYYDGRYWTMWKLPMFGCTDGTQVLAEVQE RBS0_SOLTU 118 6 -
GYYDGRYWTMWKLPMFGCTDATQVLAEVEE RBS_TOBAC 117 6 -
GYYDGRYWTMWKLPMFGCTDATQVLAEVQE RBS1_LYCES 118 6 -
GYYDGRYWTMWKLPMFGCTDATQVLAEVEE RBS8_NICPL 117 6 -
RYYDGRYWTMWKLPMFGCTDATQVLGELQE RBS1_PETSP 117 6 -
GYYDGRYWTMWKLPMFGCTDASQVLKELQE RBS4_SOYBN 115 6 -
GYYDGRYWTMWKLPLFGCTDSAQVLKEVEE RBS2_ARATH 115 6 -
GYYDGRYWTMWKLPMFGCTDSAQVMKELQE RBS_FLATR 110 6 -
GYYDGRYWTMWKLPMFGTTDASQVLKELDE RBS3_PEA 117 6 -
GFYDGRYWTMWKLPMFGCTDSSQVIQEIEE RBS_CUCSA 119 6 -
GYYDGRYWTMWKLPMFGCTDASQVIAEVEE RBS2_LEMGI 116 5 -

Motif 6 width=27
Element Seqn Id St Int Rpt
YPQAWIRIIGFDNVRQVQCISFIAYKP RBSA_SOLTU 151 4 -
YPQAWIRIIGFDNVRQVQCISFIAYKP RBS0_SOLTU 152 4 -
YPQAWIRIIGFDNVRQVQCISFIAYKP RBS_TOBAC 151 4 -
YPQAWVRIIGFDNVRQVQCISFIAYKP RBS1_LYCES 152 4 -
YPQAWVRIIGFDNVRQVQCISFIAYKP RBS8_NICPL 151 4 -
YPNAWIRIIGFDNVRQVQCISFIAYKP RBS1_PETSP 151 4 -
YPNGFIRIIGFDNVRQVQCISFIAYKP RBS4_SOYBN 149 4 -
YPGAFIRIIGFDNTRQVQCISFIAYKP RBS2_ARATH 149 4 -
YPQAWIRIIGFDNVRQVQCVSFIASKP RBS_FLATR 144 4 -
YPQAFVRIIGFDNVRQVQCISFIAHTP RBS3_PEA 151 4 -
YPDAFIRVIGFDNVRQVQCISFIAYKP RBS_CUCSA 153 4 -
YPEYFVRIIGFDNKRQVQCISFIAYKP RBS2_LEMGI 150 4 -
Final Motifs
Motif 1  width=18
Element Seqn Id St Int Rpt
QASMVAPFTGLKSTASFP RBSC_SOLTU 19 19 -
QASMVAPFTGLKSAASFP RBSA_SOLTU 19 19 -
QASMVAPFTGLKSAASFP RBS3_SOLTU 19 19 -
QARMVAPFTGLKSSSAFP Q43115 19 19 -
QASMVAPFTGLKSAASFP RBS0_SOLTU 19 19 -
QANMVAPFTGLKSAASFP RBS_TOBAC 19 19 -
QASMVGPFTGLKSTASFP RBSB_SOLTU 19 19 -
QARMVAPFTGLKSSSASP RBS_MALSP 23 23 -
QASMVAPFTGLKSTASFP RBS3_LYCES 19 19 -
QASMVAPFTGLKSTASFP RBS4_LYCES 19 19 -
QASMVAPFTGLKSAASFP RBS2_PETSP 19 19 -
QARMVAPFNGLKSSSAFP RBS_PYRPY 23 23 -
QASMVAPFTGLKSSATFP RBS2_LYCES 19 19 -
GAGMVAPFTGLKSMAGFP Q39832 18 18 -
QASMVAPFTGLKSNASFP RBS_STELP 19 19 -
QANMVAPFTGLKSNAAFP RBS4_FLAPR 18 18 -
QASMIAPFTGLKSATSFP RBS1_NICSY 20 20 -
QASMVAPFTGLKSAASFP RBS1_LYCES 19 19 -
GAGMVAPFTGLKSMAGFP RBS1_SOYBN 18 18 -
GAGMVAPFTGLKSMAGFP Q42815 18 18 -
QANMVAPFTGLKSAASFP RBS8_NICPL 19 19 -
QANMVAPFTGLKSNAAFP RBS7_FLAPR 13 13 -
QASMVAPFNGLKSAVSFP RBS1_PETSP 19 19 -
GAGMVAPFTGLKSMAGLP RBS4_SOYBN 18 18 -
QANMVAPFTGLKSNAAFP RBS5_FLAPR 13 13 -
QASMVAPFTGLKSVSAFP RBS2_MESCR 18 18 -
QANMVAPFTGLKSNAAFP RBS3_FLAPR 13 13 -
QATMVAPFTGLKSSAAFP RBS_RAPSA 17 17 -
QATMVAPFTGLKSSAAFP RBS4_ARATH 17 17 -
QANMVAPFTGLKANAAFP RBS1_FLAPR 13 13 -
QATMVAPFTGLKSSAAFP RBS2_BRANA 17 17 -
AGSMIAPFTGLKSAATFP RBS1_SOLTU 20 20 -
QATMVAPFTGLKSSASFP RBS3_ARATH 17 17 -
QATMVAPFTGLKSSASFP RBS2_ARATH 17 17 -
QANMVAPFTGLKSNVAFP RBS2_FLAPR 18 18 -
QANMVAPFNGLKSVSAFP RBS3_MESCR 21 21 -
QANMVAPFNGLKSISAFP RBS4_MESCR 21 21 -
QANMVAPFTGLKSNAAFP RBS_HELAN 18 18 -
GAGTVAPFTGLKSMAGFP RBS_GLYTA 18 18 -
QAAMVAPFTGLKSSAAFP Q43746 17 17 -
QASMVAPFNGLKSVAAFP RBS1_MESCR 20 20 -
QASMVAPFTGLKSTSAFP RBS_HEVBR 21 21 -
QANMVAPFTGLKSASAFP RBS_GOSHI 21 21 -
QATMVAPFTGLKSSSAFP RBS1_BRANA 17 17 -
QANMVAPFTGLKANAAFP RBS6_FLAPR 13 13 -
QATMVAPFNGLKSSAAFP RBS1_ARATH 17 17 -
QASMIASFNGLKSAASFP RBS_CAPAN 19 19 -
GAGTVAPFTGLKSMAGFP RBS_GLYTO 18 18 -
QTNMVAPFTGLKANAAFP RBS_FLATR 13 13 -
QSSMVAPFTCLKSTSAFP RBS_BETVE 21 21 -
QASMVAPFTGLKSVSAFP RBS6_MESCR 23 23 -
QATMVAPFTGLKSTAAFP RBS_FAGCR 21 21 -
QANLVAPFTGLKSSAGFP RBS_MEDSA 19 19 -
GAGMVAPFTGLKSLGGFP Q43874 20 20 -
QSAAVAPFGGLKSMTGFP RBS3_PEA 20 20 -
QSAAVAPFGGLKSMTGFP RBS2_PEA 20 20 -
QASMVAPFTGLKSTVGFP O20253 20 20 -
QASMVAPFTGLKSTVGFP RBS2_SPIOL 20 20 -
QASLAAPFTGLKSNVAFP RBS_LACSA 19 19 -
QANMVAPFNGLKSISAFP RBS5_MESCR 21 21 -
QATMVAPFTGLKSTPVFP RBS_MANES 21 21 -
QASMVAPFNGLKSFATFP RBS_AMAHP 21 21 -
QANLATPFTGLKSSAGFP RBS_TRIRP 18 18 -
QANMVAPFSGLKSTSAFP RBS_SILPR 18 18 -
QSSMVAPFNGLRSSVAFP RBS5_LEMGI 19 19 -
QTNMVAPFNGLRSSVAFP RBS6_LEMGI 19 19 -
QASMVAPFTGLKSSAGFP RBS_CUCSA 21 21 -
QASMVAPFVGLKSASAFP RBS3_FRIAG 21 21 -
QASMVAPFVGLKSASAFP RBS2_FRIAG 21 21 -
QSNMVAPFNGLRSSVAFP RBS2_LEMGI 19 19 -
QASMVAPFVGLKSTSAFP RBS1_FRIAG 21 21 -
QASMVAPFVGLKSASAFP RBS5_FRIAG 21 21 -
SATTVAPFQGLKSTAGMP RBS3_ORYSA 9 9 -
SATTVAPFQGLKSTAGMP Q36688 4 4 -
QSSMVAPFTGLKSASAFP RBS_MUSAC 20 20 -
SATTVAPFQGLKSTAGMP O65105 9 9 -
SATSVAPFQGLKSTAGLP RBS2_ORYSA 9 9 -
QTNMVGAFNGCRSSVAFP RBS1_LEMGI 15 15 -
SATSVAPFQGLKSTAGLP O22487 9 9 -
SATSVAPFQGLKSTAGLP RBS_HORVU 9 9 -
SATTVAPFQGLKSTAGLP RBS2_WHEAT 9 9 -
SATAVAPFQGLKSAASLP O24574 10 10 -
AATVVSAFTGLKSTAQFP RBS_PINTH 9 9 -
SATTVAPFQGLKSTAGLP RBS1_WHEAT 9 9 -
QSNMVVPFAGLHSSAAFP RBS_ZANAE 19 19 -
AQTNMVPFNACRSSVPFP RBS4_LEMGI 19 19 -
SATAVAPFQGLKSTASLP RBS_MAIZE 10 10 -
AQSSMVPFNACRSSVPFP RBS3_LEMGI 19 19 -
NSNVVSAFTGLKSMAQFP RBS_LARLA 25 25 -
SATSVAPFQGLKSTAGLP RBS_AEGSQ 9 9 -
SATAAAPFQGLKSTASLP RBS_SACHY 9 9 -
SATTVAPFQGSSPPPACR RBS1_ORYSA 9 9 -
AESLSKSFSGLKANTLFA Q43110 19 19 -

Motif 2 width=19
Element Seqn Id St Int Rpt
TSIASNGGRVRCMQVWPPI RBSC_SOLTU 46 9 -
TSIASNGGRVRCMQVWPPI RBSA_SOLTU 46 9 -
TSLASNGGRVRCMQVWPPI RBS3_SOLTU 47 10 -
TSIASNGGRVQCMQVWPPL Q43115 45 8 -
TSLASNGGRVRCMQVWPPI RBS0_SOLTU 47 10 -
TSIASNGGRVQCMQVWPPI RBS_TOBAC 46 9 -
TSIASNGGRVRCMQVWPPI RBSB_SOLTU 46 9 -
TSIASNGGRVQCMQVWPPL RBS_MALSP 49 8 -
TSIASNGGRVSCMQVWPPI RBS3_LYCES 46 9 -
TSIASNGGRVSCMQVWPPI RBS4_LYCES 46 9 -
TSIASNGGRVQCMQVWPPY RBS2_PETSP 46 9 -
TSIASNGGRVQCMQVWPPL RBS_PYRPY 49 8 -
TSIASNGGRVSCMQVWPPI RBS2_LYCES 46 9 -
TSIASNGGRVQCMQVWPPV Q39832 44 8 -
TSIASNGGRVRCMQVWPPI RBS_STELP 46 9 -
STLPSNGGRVQCMKVWPPL RBS4_FLAPR 44 8 -
TSIASNGGRVQCMQVWPPI RBS1_NICSY 47 9 -
TSLASNGGRVRCMQVWPPI RBS1_LYCES 47 10 -
TSIASNGGRVQCMQVWPPI RBS1_SOYBN 44 8 -
TSIASNGGRVQCMQVWPPV Q42815 44 8 -
TSIASNGGRVQCMQVWPPI RBS8_NICPL 46 9 -
STLASNGGRVQCMKVWPPL RBS7_FLAPR 39 8 -
TSIASNGGRVQCMQVWPPY RBS1_PETSP 46 9 -
TSIASNGGRVQCMQVWPPV RBS4_SOYBN 44 8 -
STLPSNGGRVQCMKVWPPL RBS5_FLAPR 39 8 -
TSIASNGGRVQCMQVWPPL RBS2_MESCR 44 8 -
STLPSNGGRVQCMKVWPPL RBS3_FLAPR 39 8 -
TSIASNGGRVSCMKVWPPI RBS_RAPSA 44 9 -
TSITSNGGRVSCMKVWPPI RBS4_ARATH 44 9 -
STLPSNGGRVQCMKVWPPL RBS1_FLAPR 39 8 -
TSIASNGGRVSCMKVWPPV RBS2_BRANA 44 9 -
TSIASNGGRVRCMQVWPPI RBS1_SOLTU 47 9 -
TSITSNGGRVSCMKVWPPI RBS3_ARATH 44 9 -
TSITSNGGRVSCMKVWPPI RBS2_ARATH 44 9 -
STLPSNGGRVQCMKVWPPL RBS2_FLAPR 44 8 -
TSVASNGGRVQCMQVWPPL RBS3_MESCR 47 8 -
TSVASNGGRVQCMQVWPPL RBS4_MESCR 47 8 -
STLPSNGGRVQCMKVWPPL RBS_HELAN 44 8 -
ASIASNGGRVQCMQVWPTT RBS_GLYTA 44 8 -
TSIASNGGRVNCMKVWPPV Q43746 44 9 -
TSVATNGGRVQCMQVWPPL RBS1_MESCR 46 8 -
TSIASNGGRVQCMQVWPPR RBS_HEVBR 48 9 -
TSLASNGGRVQCMQVWPPL RBS_GOSHI 48 9 -
TSIVSNGGRVSCMKVWPPV RBS1_BRANA 44 9 -
STLPSNGGRVQCMKVWPPL RBS6_FLAPR 39 8 -
TSITSNGGRVNCMQVWPPI RBS1_ARATH 44 9 -
TSIASNGGRVECMLVWPPI RBS_CAPAN 46 9 -
ASIASNGGRVQCMQVWPTT RBS_GLYTO 44 8 -
STLPSNGGRVQCMKVWPPV RBS_FLATR 39 8 -
TSIASNGGRVQCMQVWPPL RBS_BETVE 48 9 -
STVPSNGGKVQCMQVWPPL RBS6_MESCR 50 9 -
TSLASNGGRVQCMKVWPPL RBS_FAGCR 48 9 -
TSIASNGGRVNCMQVWPPV RBS_MEDSA 46 9 -
TSVANNGGRVQCIQVWPTV Q43874 46 8 -
TSITSNGGRVKCMQVWPPI RBS3_PEA 46 8 -
TSITSNGGRVKCMQVWPPI RBS2_PEA 46 8 -
TSLASNGGRVQCMKVWPTQ O20253 46 8 -
TSLASNGGRVQCMKVWPTQ RBS2_SPIOL 46 8 -
SSLPSNGGRVQCMKVWPPI RBS_LACSA 46 9 -
TSVASNGGRVQCMVWPPLG RBS5_MESCR 47 8 -
TSITSNGGKVQCMKVWPTL RBS_MANES 48 9 -
SSLPSNGGRVQCMQVWPPV RBS_AMAHP 48 9 -
TSITSNGSRVNCMQVWPPV RBS_TRIRP 44 8 -
TSLATNGGRVNCMQVWPPR RBS_SILPR 45 9 -
STLPSNGGRVSCMQVWPPE RBS5_LEMGI 46 9 -
STLPSNGGRVSCMQVWPPE RBS6_LEMGI 46 9 -
TTLASNAGKVQCMKVWPPL RBS_CUCSA 48 9 -
STLPSNGGRVQCMKVWPIV RBS3_FRIAG 48 9 -
STLPSNGGRVQCMKVWPIV RBS2_FRIAG 48 9 -
STLPSNGGKVSCMQVWPPE RBS2_LEMGI 46 9 -
STLPSNGGRVQCMKVWPIV RBS1_FRIAG 48 9 -
STLPSNGGRVQCMKVWPIV RBS5_FRIAG 48 9 -
FGNVSNGGRIRCMQVWPIE RBS3_ORYSA 36 9 -
FGNVSNGGRIRCMQVWPIE Q36688 30 8 -
SHLPSNGGRVQCMKVWPIE RBS_MUSAC 47 9 -
FGNVSNGGRIRCMQVWPIE O65105 36 9 -
FGNVSNGGRIKFMQVWPIE RBS2_ORYSA 36 9 -
STLPSSGGRVSCMQVWPPE RBS1_LEMGI 42 9 -
FGNVSNGGRIKCMQVWPIE O22487 36 9 -
SASVSNGGRIRCMQVWPIE RBS_HORVU 35 8 -
LSSVSNGGRIRCMQVWPIE RBS2_WHEAT 36 9 -
LGNVSNGGRIRCMQVWPAY O24574 36 8 -
QKTTSNGGRVRCMQVWPPF RBS_PINTH 40 13 -
LGSVSNGGRIRCMQVWPIE RBS1_WHEAT 35 8 -
SKLPSNGLRVRCMQVWPPE RBS_ZANAE 45 8 -
STLPSNGGRVSCMQVWPPE RBS4_LEMGI 46 9 -
LGNVSNGGRIRCMQVWPAY RBS_MAIZE 36 8 -
STLPGNGGRVSCMQVWPPE RBS3_LEMGI 46 9 -
QKTTSNGSRVRCMQVWPPY RBS_LARLA 56 13 -
LGSVSNGGRIRCMQVWPIE RBS_AEGSQ 36 9 -
LAKVSNGGRIRCMQVWPAY RBS_SACHY 35 8 -
LRQRQHGGRIRCMQVWPIE RBS1_ORYSA 34 7 -
PLAISNGSRISAMLVWKPY Q43110 42 5 -

Motif 3 width=27
Element Seqn Id St Int Rpt
KKYETLSYLPDLSDEQLLKEVEYLLKN RBSC_SOLTU 67 2 -
KKYETLSYLPDLSDEQLLKEVEYLLKN RBSA_SOLTU 67 2 -
KKYETLSYLPDLSDEQLLKEVEYLLKN RBS3_SOLTU 68 2 -
KKFETLSYLPPLSTESLAKEVDYLLRK Q43115 66 2 -
KKYETLSYLPDLSDEQLLKEVEYLLKN RBS0_SOLTU 68 2 -
KKYETLSYLPDLSQEQLLSEVEYLLKN RBS_TOBAC 67 2 -
KKYETLSYLPDLSDEQLLKEVEYLLKN RBSB_SOLTU 67 2 -
KKFETLSYLPPLSTESLAKEVDYLLRK RBS_MALSP 70 2 -
KKYETLSYLPDLSDEQLLSEIEYLLKN RBS3_LYCES 67 2 -
KKYETLSYLPDLSDEQLLSEIEYLLKN RBS4_LYCES 67 2 -
KKYETLSYLPDLTDEQLLKEIEYLLNK RBS2_PETSP 67 2 -
KKFETLSYLPPLSSESLAKEVDYLLRK RBS_PYRPY 70 2 -
KKYETLSYLPDLSDEQLLSEIEYLLKN RBS2_LYCES 67 2 -
KKFETLSYLPDLDDAQLAKEVEYLLRK Q39832 65 2 -
KKYETLSYLPDLSSEQLLSEIEYLLKN RBS_STELP 67 2 -
KKYETLSYLPNLTEAQLAKEVDYLLRN RBS4_FLAPR 65 2 -
KKYETLSYLPDLSEEQLLREVEYLLKN RBS1_NICSY 68 2 -
KKYETLSYLPDLSDEQLLSEIEYLLKN RBS1_LYCES 68 2 -
KKFETLSYLPDLDDAQLAKEVEYLLRK RBS1_SOYBN 65 2 -
KKFETLSYLPDLDDAQLAKEVEYLLRK Q42815 65 2 -
KKYETLSYLPDLSQEQLLSEIEYLLKS RBS8_NICPL 67 2 -
KRYETLSYLPNLTEVQLAKEVDYLLRN RBS7_FLAPR 60 2 -
KKYETLSYLPDLTDEQLLKEIEYLLNK RBS1_PETSP 67 2 -
KKFETLSYLPDLDDAQLAKEVEYLLRK RBS4_SOYBN 65 2 -
KRYETLSYLPNLTEVQLAKEVDYLLRN RBS5_FLAPR 60 2 -
KKFETLSYLPPLSEESLMKEVQYLLNN RBS2_MESCR 65 2 -
KRYETLSYLPNLTESQLAKEVDYLLRN RBS3_FLAPR 60 2 -
KKFETLSYLPDLSDVELAKEVDYLLRN RBS_RAPSA 65 2 -
KKFETLSYLPDLSDVELAKEVDYLLRN RBS4_ARATH 65 2 -
KKYETLSYLPDLTEVQLAKEVDYLLRN RBS1_FLAPR 60 2 -
KKFETLSYLPDLTEVELGKEVDYLLRN RBS2_BRANA 65 2 -
KKYETLSYLPDLTDEQLLKEVEYLLKN RBS1_SOLTU 68 2 -
KKFETLSYLPDLSDVELAKEVDYLLRN RBS3_ARATH 65 2 -
KKFETLSYLPDLTDVELAKEVDYLLRN RBS2_ARATH 65 2 -
KRYETLSYLPNLTEAQLAKEVDYLLRN RBS2_FLAPR 65 2 -
KKFETLSYLPPLSEESLMKEVQYLLNN RBS3_MESCR 68 2 -
KKFETLSYLPPLSEESLLKEVQYLLNN RBS4_MESCR 68 2 -
KKYETLSYLPPLTETQLAKEVDYLLRK RBS_HELAN 65 2 -
KKFETLSYLPDLDDAQLAKEVEYLLRK RBS_GLYTA 65 2 -
KKFETLSYLPDLTDVELAKEVDYLLRN Q43746 65 2 -
KKFETLSYLPPLSEESLMKEVQYLLNN RBS1_MESCR 67 2 -
KFYETLSYLPPLTREQLAKEVEYLLRK RBS_HEVBR 69 2 -
KKFETLSYLPDLTPVQLAKEVDYLLRS RBS_GOSHI 69 2 -
KKFETLSYLPDLTEVELGKEVDYLLRN RBS1_BRANA 65 2 -
KKYXTLSYLPNLTEAQLAKEVDYLLRN RBS6_FLAPR 60 2 -
KKFETLSYLPDLTDSELAKEVDYLIRN RBS1_ARATH 65 2 -
KKYETLSYLPDLSDEQLLKEIEYLLQK RBS_CAPAN 67 2 -
KKFETLSYLPDLDDAQLAKEVEYLLRK RBS_GLYTO 65 2 -
KKYETLSYLPELTEAQLAKEVDYLLRN RBS_FLATR 60 2 -
KKFETLSYLPPLSSEQLAKEVDYLLRK RBS_BETVE 69 2 -
KKFETLSYLPPLSEESLLKEVQYLLNN RBS6_MESCR 71 2 -
QKFETLSYLPPLSIESLAKQIEYLILK RBS_FAGCR 69 2 -
KKFETLSYLPPLTEEQLAKEVEYLIRK RBS_MEDSA 67 2 -
KKFETLSYLPPLTKQQLAKEVDYLLRK Q43874 67 2 -
KKFETLSYLPPLTRDQLLKEVEYLLRK RBS3_PEA 67 2 -
KKFETLSYLPPLTRDQLLKEVEYLLRK RBS2_PEA 67 2 -
KRYETLSYLPPLTTDQLARQVDYLLNN O20253 67 2 -
KRYETLSYLPPLTTDQLARQVDYLLNN RBS2_SPIOL 67 2 -
KKYETLSYLPPLSDEALSKEIDYLIRN RBS_LACSA 67 2 -
KKFETLSYLPPLSEESLLKEVQYLLNN RBS5_MESCR 67 1 -
KKFETLSYLPPLTREQLASEVEYLLRS RBS_MANES 69 2 -
KKFETLSYLPPLSDAQLLAQVQYLLNK RBS_AMAHP 69 2 -
KKFETLSYLPPLTDEQLLKEVEYLLRK RBS_TRIRP 65 2 -
KKFETLSYLPTLSEESLLKEINYLLIK RBS_SILPR 66 2 -
KKFETLSYLPPLSVEDLAKEVDYLLRN RBS5_LEMGI 67 2 -
KKFETLSYLPPLSVEDLAKEVDYLLRN RBS6_LEMGI 67 2 -
RKFETLSYLPDMSNEQLSKECDYLLRN RBS_CUCSA 69 2 -
KKFETLSYLPTLSVESLLKQIEYLIRN RBS3_FRIAG 69 2 -
KKFETLSYLPTLSVESLLKQIEYLIRN RBS2_FRIAG 69 2 -
KKFETLSYLPPLSVEDLAKEVDYLLRN RBS2_LEMGI 67 2 -
KKFETLSYLPTLSVESLLKQIEYLIRN RBS1_FRIAG 69 2 -
KKFETLSYLPTLSVESLLKQIEYLIRN RBS5_FRIAG 69 2 -
KKFETLSYLPPLTVEDLLKQIEYLLRS RBS3_ORYSA 57 2 -
KKFETLSYLPPLTVEDLLKQIEYLLRS Q36688 51 2 -
KKFETLSYLPTMKDEALVKQIEYLLRS RBS_MUSAC 68 2 -
KKFETLSYLPPLTVEDLLKQIEYLLRS O65105 57 2 -
KKFETLSYLPPLTVEDLLKQIEYLLRS RBS2_ORYSA 57 2 -
KKFETLSYLPPLSVEDLAKEVDYLLRN RBS1_LEMGI 63 2 -
KKFETLSYLPPLTVEDLLKQIEYLLRS O22487 57 2 -
KKFETLSYLPPLSTEALLKQVDYLIRS RBS_HORVU 56 2 -
KKFETLSYLPPLSTEALLKQVDYLIRS RBS2_WHEAT 57 2 -
KKFETLSYLPPLSTDDLLKQVDYLLRN O24574 57 2 -
PKFETLSYLPTLTEEQLVKEVEYLLRN RBS_PINTH 61 2 -
KKFETLSYLPPLSTEALSKQVDYLIRS RBS1_WHEAT 56 2 -
KKFETLSYLPPLTREQLGQEVDYLIRN RBS_ZANAE 66 2 -
KKFETLSYLPPLSVEDLAKEVDYLLRN RBS4_LEMGI 67 2 -
KKFETLSYLPPLSTDDLLKQVDYLLRN RBS_MAIZE 57 2 -
KKFETLSYLPPLSVEDLAKEVDYLLRN RBS3_LEMGI 67 2 -
KKFETLSYLPRLTPEQLVKEVEYLLKN RBS_LARLA 77 2 -
KKFETLSYLPPLSTEGLLKQVDYLIRS RBS_AEGSQ 57 2 -
KKFETLSYLPPLTQEQLLKQVDYLLRN RBS_SACHY 56 2 -
KKFETLSYLPPLTVEDLLKQIEYLAPF RBS1_ORYSA 55 2 -
KKFETLSYLPPLTNDQIAKQVEYMVRK Q43110 63 2 -

Motif 4 width=16
Element Seqn Id St Int Rpt
WVPCLEFETEHGFVYR RBSC_SOLTU 95 1 -
WVPCLEFETEHGFVYR RBSA_SOLTU 95 1 -
WVPCLEFETEHGFVYR RBS3_SOLTU 96 1 -
WVPCLEFELEHGFVYR Q43115 94 1 -
WVPCLEFETEHGFVYR RBS0_SOLTU 96 1 -
WVPCLEFETEHGFVYR RBS_TOBAC 95 1 -
WVPCLEFETEHGFVYR RBSB_SOLTU 95 1 -
WVPCLEFELEHGFVYR RBS_MALSP 98 1 -
WVPCLEFETEHGFVYR RBS3_LYCES 95 1 -
WVPCLEFETEHGFVYR RBS4_LYCES 95 1 -
WVPCLEFETEHGFVYR RBS2_PETSP 95 1 -
WVPCLEFELETGFVYR RBS_PYRPY 98 1 -
WVPCLEFETEHGFVYR RBS2_LYCES 95 1 -
WIPCLEFELEHGFVYR Q39832 93 1 -
WVPCLEFETEHGFVYR RBS_STELP 95 1 -
WVPCLEFELEHGFVYR RBS4_FLAPR 93 1 -
WVPCLEFETEHGFVYR RBS1_NICSY 96 1 -
WVPCLEFETERGFVYR RBS1_LYCES 96 1 -
WIPCLEFELEHGFVYR RBS1_SOYBN 93 1 -
WIPCLEFELEHGFVYR Q42815 93 1 -
WVPCLEFETERGFVYR RBS8_NICPL 95 1 -
WVPCLEFELEHGFVYR RBS7_FLAPR 88 1 -
WVPCLEFETEHGFVYR RBS1_PETSP 95 1 -
WIPCLEFELEHGFVYR RBS4_SOYBN 93 1 -
WVPCLEFELEHGFVYR RBS5_FLAPR 88 1 -
WVPCLEFEPTHGFVYR RBS2_MESCR 93 1 -
WVPCLEFELEHGFVYR RBS3_FLAPR 88 1 -
WIPCVEFELEHGFVYR RBS_RAPSA 93 1 -
WIPCVEFELEHGFVYR RBS4_ARATH 93 1 -
WVPCLEFELEHGFVYR RBS1_FLAPR 88 1 -
WIPCVEFELEHGFVYR RBS2_BRANA 93 1 -
WVPCLEFETEHGFVYR RBS1_SOLTU 96 1 -
WIPCVEFELEHGFVYR RBS3_ARATH 93 1 -
WIPCVEFELEHGFVYR RBS2_ARATH 93 1 -
WVPCLEFELEHGFVYR RBS2_FLAPR 93 1 -
WVPCLEFEPTHGFVYR RBS3_MESCR 96 1 -
WVPCLEFEPTHGFVYR RBS4_MESCR 96 1 -
WVPCLEFELEHGFVYR RBS_HELAN 93 1 -
WIPCLEFELEHGFVYR RBS_GLYTA 93 1 -
WIPCVEFELEHGFVYR Q43746 93 1 -
WVPCLEFEPTHGFVYR RBS1_MESCR 95 1 -
WVPCLEFELEHGTVYR RBS_HEVBR 97 1 -
WIPCLEFELEEGFVHR RBS_GOSHI 97 1 -
WIPCVEFELEHGFVYR RBS1_BRANA 93 1 -
WVPCLEFELEHGFVYR RBS6_FLAPR 88 1 -
WIPCVEFELEHGFVYR RBS1_ARATH 93 1 -
WVPCLEFETEHGFVYR RBS_CAPAN 95 1 -
WIPCLEFELEHGFVYR RBS_GLYTO 93 1 -
WVPCLEFELEHGFVYR RBS_FLATR 88 1 -
LIPCLEFELEHGFVYR RBS_BETVE 97 1 -
WVPCLEFEPTHGFVYR RBS6_MESCR 99 1 -
WIPCLEFELEHPFVYR RBS_FAGCR 97 1 -
WIPCLEFELEKGFVYR RBS_MEDSA 95 1 -
WVPCLEFELEHGFVYR Q43874 95 1 -
WVPCLEFELEKGFVYR RBS3_PEA 95 1 -
WVPCLEFELEKGFVYR RBS2_PEA 95 1 -
WVPCLEFETDHGFVYR O20253 95 1 -
WVPCLEFETDHGFVYR RBS2_SPIOL 95 1 -
WIPCLEFELEHGFVYR RBS_LACSA 95 1 -
WVPCLEFEPTHGFVYR RBS5_MESCR 95 1 -
WIPCLEFELEHGLVYR RBS_MANES 97 1 -
WIPCIEFELEHPFVYR RBS_AMAHP 97 1 -
WVPCVEFELEKGFVHR RBS_TRIRP 93 1 -
WVPCLEFEVGPAHVYR RBS_SILPR 94 1 -
WVPCIEFSKEGFVYRE RBS5_LEMGI 95 1 -
WVPCIEFSKEGFVYRE RBS6_LEMGI 95 1 -
WVPCVEFDIGSGFVYR RBS_CUCSA 97 1 -
WVPCLEFSLEGFVSRD RBS3_FRIAG 97 1 -
WVPCLEFSLEGFVSRD RBS2_FRIAG 97 1 -
WVPCIEFSKEGFVYRE RBS2_LEMGI 95 1 -
WVPCLEFSLEGFVSRD RBS1_FRIAG 97 1 -
WVPCLEFSLEGFVSRD RBS5_FRIAG 97 1 -
WVPCLEFSKVGFVYRE RBS3_ORYSA 85 1 -
WVPCLEFSKVGFVYRE Q36688 79 1 -
WIPCLEFCPKGFVWRE RBS_MUSAC 96 1 -
WVPCLEFSKVGFVYRE O65105 85 1 -
WVPCLEFSKVGFVYRE RBS2_ORYSA 85 1 -
WVPCIEFSKEGFVYRE RBS1_LEMGI 91 1 -
WVPCLEFSKVGFVYRE O22487 85 1 -
WVPCLEFSKVGFIFRE RBS_HORVU 84 1 -
WVPCLEFSKVGFVFRE RBS2_WHEAT 85 1 -
WIPCLEFSKLGFVYRE O24574 85 1 -
WVPCLEFDLEGSISRK RBS_PINTH 89 1 -
WVPCLEFSKVGFVFRE RBS1_WHEAT 84 1 -
WIPCIEFCKVGFVYRE RBS_ZANAE 94 1 -
WVPCIEFSKEGFVYRE RBS4_LEMGI 95 1 -
WIPCLEFSKVGFVYRE RBS_MAIZE 85 1 -
WVPCIEFSKEGFVYRE RBS3_LEMGI 95 1 -
WVPCLEFEEDGEIKRV RBS_LARLA 105 1 -
WVPCLEFRKVGFIFRE RBS_AEGSQ 85 1 -
WVPCLEFSKEGFVYRE RBS_SACHY 84 1 -
VVPCLEFSKVGFVYRE RBS1_ORYSA 83 1 -
WTPCIEFDTIGSVYRE Q43110 91 1 -

Motif 5 width=30
Element Seqn Id St Int Rpt
GYYDGRYWTMWKLPMFGCTDATQVLAEVEE RBSC_SOLTU 117 6 -
GYYDGRYWTMWKLPMFGCTDATQVLAEVEE RBSA_SOLTU 117 6 -
GYYDGRYWTMWKLPMFGCTDATQVLAEVQE RBS3_SOLTU 118 6 -
GYYDGRYWTMWKLPMFGCTDSSQVLKELEE Q43115 116 6 -
GYYDGRYWTMWKLPMFGCTDGTQVLAEVQE RBS0_SOLTU 118 6 -
GYYDGRYWTMWKLPMFGCTDATQVLAEVEE RBS_TOBAC 117 6 -
GYYDGRYWTMWKLPMFGCTDATQVLAEVEE RBSB_SOLTU 117 6 -
GYYDGRYWTMWKLPMFGCTDSSQVLKELEE RBS_MALSP 120 6 -
GYYDGRYWTMWKLPMFGCTDATQVLAEVQE RBS3_LYCES 117 6 -
GYYDGRYWTMWKLPMFGCTDATQVLAEVQE RBS4_LYCES 117 6 -
RYYDGRYWTMWKLPMFGCTDATQVLGELQE RBS2_PETSP 117 6 -
GYYDGRYWTMWKLPMFGCTDSSQVLKELEE RBS_PYRPY 120 6 -
GYYDGRYWTMWKLPMFGCTDATQVLAEVQE RBS2_LYCES 117 6 -
GYYDGRYWTMWKLPMFGCTDASQVLKELQE Q39832 115 6 -
GYYDGRYWTMWKLPMFGCTDATQVAAEVQE RBS_STELP 117 6 -
GYYDGRYWTMWKLPMFGCTDSAQVMKELQE RBS4_FLAPR 115 6 -
GYYDGRYWTMWKLPMFGCTDATQVLAEVEE RBS1_NICSY 118 6 -
GYYDGRYWTMWKLPMFGCTDATQVLAEVQE RBS1_LYCES 118 6 -
XYYDGRYWTMWKLPMFGCTDASQVLKELQE RBS1_SOYBN 115 6 -
GYYDGRCWTMWKLPMFGCTDASQVLKELQE Q42815 115 6 -
GYYDGRYWTMWKLPMFGCTDATQVLAEVEE RBS8_NICPL 117 6 -
GYYDGRYWTMWKLPMFGCTDSAQVMKELQE RBS7_FLAPR 110 6 -
RYYDGRYWTMWKLPMFGCTDATQVLGELQE RBS1_PETSP 117 6 -
GYYDGRYWTMWKLPMFGCTDASQVLKELQE RBS4_SOYBN 115 6 -
GYYDGRYWTMWKLPMFGCTDSAQVMKELQE RBS5_FLAPR 110 6 -
GYYDGRYWTMWKLPMFGCTDPSQVVAELEE RBS2_MESCR 115 6 -
GYYDGRYWTMWKLPMFGCTDSAQVMKELQE RBS3_FLAPR 110 6 -
GYYDGRYWTMWKLPLFGCTDSAQVLKEVQE RBS_RAPSA 115 6 -
GYYDGRYWTMWKLPLFGCTDSAQVLKEVEE RBS4_ARATH 115 6 -
GYYDGRYWTMWKLPMFGCTDSAQVMKELQE RBS1_FLAPR 110 6 -
GYYDGRYWTMWKLPLFGCTDSAQVLKEVQE RBS2_BRANA 115 6 -
GYYDGRYWTMWKLPMFGCTDATQVLAEVQE RBS1_SOLTU 118 6 -
GYYDGRYWTMWKLPLFGCTDSAQVLKEVEE RBS3_ARATH 115 6 -
GYYDGRYWTMWKLPLFGCTDSAQVLKEVEE RBS2_ARATH 115 6 -
GYYDGRYWTMWKLPMFGCTDSAQVMKELQE RBS2_FLAPR 115 6 -
GYYDGRYWTMWKLPMFGCTDPSQVVAELEE RBS3_MESCR 118 6 -
GYYDGRYWTMWKLPMFGCTDPSQVVAELEE RBS4_MESCR 118 6 -
GYYDGRYWTMWKLPMFGCTDSAQVMKELAE RBS_HELAN 115 6 -
GYYDGRYWTMWKLPMFGCTDASQVLKELQE RBS_GLYTA 115 6 -
GYNDGRYWTMWKLPLFGCTDSAQVLKEVQE Q43746 115 6 -
GYYDGRYWTMWKLPMFGCTDPSQVVAELEE RBS1_MESCR 117 6 -
GYYDGRYWTMWKLPMFGCTDAVQVLQELDE RBS_HEVBR 119 6 -
TYYDGRYWTMWKLPMFGCTDSAQVLEELEN RBS_GOSHI 119 6 -
GYYDGRYWTMWKLPLFGCTDSAQVLKEVQE RBS1_BRANA 115 6 -
GYYDGRYWTMWKLPMFGCTDSVQVMKELQE RBS6_FLAPR 110 6 -
GYYDGRYWTMWKLPLFGCTDSAQVLKEVEE RBS1_ARATH 115 6 -
GYYDGRYWTMWKLPMFGCTDATQVLNEVQE RBS_CAPAN 117 6 -
GYYDGRYWTMWKLPVFGCTDASQVLKELQE RBS_GLYTO 115 6 -
GYYDGRYWTMWKLPMFGCTDSAQVMKELQE RBS_FLATR 110 6 -
GYYDGRYWTMWKLPMFGCNDSSQVLKELEE RBS_BETVE 119 6 -
GYYDGRYWTMWKLPMFGCTDPSQVVAELEE RBS6_MESCR 121 6 -
GYYDGRYWVMWKLPMFGCTDATQVLAELQE RBS_FAGCR 119 6 -
GYYDGRYWTMWRLPLFGATDSSQVLKELAD RBS_MEDSA 117 6 -
GYYDGRYWTMWKLPMFGCTDSSQVLKELYE Q43874 117 6 -
GYYDGRYWTMWKLPMFGTTDASQVLKELDE RBS3_PEA 117 6 -
GYYDGRYWTMWKLPMFGTTDASQVLKELDE RBS2_PEA 117 6 -
GYYDGRYWTMWKLPMFGCTDPAQVLNELEE O20253 117 6 -
GYYDGRYWTMWKLPMFGCTDPAQVLNELEE RBS2_SPIOL 117 6 -
GYYDGRYWTMWKLPMFGCTDSAQVMKEVGE RBS_LACSA 117 6 -
GYYDGRYWTMWKLPMFGCTDPSQVVAELEE RBS5_MESCR 117 6 -
GYYDGRYWTMWKLPMFGCTDAAQVLKELDE RBS_MANES 119 6 -
GYQDGRYWTMWKLPMYGCTDPAQVLNEVEE RBS_AMAHP 119 6 -
GYYDGRYWTMWRLPLFGTTDAAQVLKEVAE RBS_TRIRP 115 6 -
GYYDGRYWTMWKLPMFGCTDASQVAAEVVE RBS_SILPR 116 6 -
GYYDGRYWTMWKLPMFGCTDASQVIAEVEE RBS5_LEMGI 116 5 -
GYYDGRYWTMWKLPMFGCTDASQVIAEVEE RBS6_LEMGI 116 5 -
GFYDGRYWTMWKLPMFGCTDSSQVIQEIEE RBS_CUCSA 119 6 -
GYYDGRYWTMWKLPMFGCTDAAQVVKEAAE RBS3_FRIAG 118 5 -
GYYDGRYWTMWKLPMFGCTDAAQVVKEAAE RBS2_FRIAG 118 5 -
GYYDGRYWTMWKLPMFGCTDASQVIAEVEE RBS2_LEMGI 116 5 -
GYYDGRYWTMWKLPMFGCTDAAQVVKEAAE RBS1_FRIAG 118 5 -
GYYDGRYWTMWKLPMFGCTGAAQVVKEAAE RBS5_FRIAG 118 5 -
GYYDGRYWTMWKLPMFGCTDATQVLKELEE RBS3_ORYSA 106 5 -
GYYDGRYWTMWKLPMFGCTDATQVLKELEE Q36688 100 5 -
GYYDGRYWTMWKLPMFGCTDAVQVAKEVEE RBS_MUSAC 117 5 -
GYYDGRYWTMWKLPMFGCTDATQVLKELEE O65105 106 5 -
GYYDGRYWTMWKLPMFGCTDATQVLKELEE RBS2_ORYSA 106 5 -
GYYDGRYWTMWKLPMFGCTDASQVIAEVEE RBS1_LEMGI 112 5 -
GYYDGRYWTMWKLPMFGCTDATQVLKELED O22487 106 5 -
GYYDGRYWTMWKLPMFGCTDATQVLNEVEE RBS_HORVU 105 5 -
GYYDGRYWTMWKLPMFGCTDATQVLNEVEE RBS2_WHEAT 106 5 -
CYYDGRYWTMWKLPMFGCTDATQVYKELQE O24574 106 5 -
GYYDGRYWVMWKLPMFGCTEASQVINEVRE RBS_PINTH 110 5 -
GYYDGRYWTMWKLPMFGCTDATQVLNEVEE RBS1_WHEAT 105 5 -
GYYDGRYWTMWKLPMFGCTDSSQVLKEVDE RBS_ZANAE 115 5 -
GYYDGRYWTMWKLPMFGCTDASQVIAEVEE RBS4_LEMGI 116 5 -
CYYDGRYWTMWKLPMFGCNDATQVYKELQE RBS_MAIZE 106 5 -
GYYDGRYWTMWKLPMFGCTDASQVIAEVEE RBS3_LEMGI 116 5 -
GYYDGRYWVMWKLPMFGCTEASQVLNEVNE RBS_LARLA 126 5 -
GYYDGRYWTMWKLPMFGCPAPTQVIPEVEE RBS_AEGSQ 106 5 -
CYYDGRYWTMWKLPMFGCTDASQVYKELQE RBS_SACHY 105 5 -
GYYDGRYWTMWKLPMFGCTDATQVVKELEE RBS1_ORYSA 104 5 -
GYYDGRYWIMWKLPMFGCTDSGSVLREIAE Q43110 112 5 -

Motif 6 width=27
Element Seqn Id St Int Rpt
YPQAWIRIIGFDNVRQVQCISFIAYKP RBSC_SOLTU 151 4 -
YPQAWIRIIGFDNVRQVQCISFIAYKP RBSA_SOLTU 151 4 -
YPQAWIRIIGFDNVRQVQCISFIAYKP RBS3_SOLTU 152 4 -
YPQSFIRIIGFDNVRQVQCISFIAYKP Q43115 150 4 -
YPQAWIRIIGFDNVRQVQCISFIAYKP RBS0_SOLTU 152 4 -
YPQAWIRIIGFDNVRQVQCISFIAYKP RBS_TOBAC 151 4 -
YPQAWIRIIGFDNVRQVQCISFIAYKP RBSB_SOLTU 151 4 -
YPQSFIRIIGFDNVRQVQCISFIAYKP RBS_MALSP 154 4 -
YPQAWVRIIGFDNVRQVQCISFIAYKP RBS3_LYCES 151 4 -
YPQAWVRIIGFDNVRQVQCISFIAYKP RBS4_LYCES 151 4 -
YPNAWIRIIGFDNVRQVQCISFIAYKP RBS2_PETSP 151 4 -
YPQSFIRIIGFDNVRQVQCISFIAYKP RBS_PYRPY 154 4 -
YPQAWVRIIGFDNVRQVQCISFIAYKP RBS2_LYCES 151 4 -
YPNGFIRIIGFDNVRQVQCISFIAYKP Q39832 149 4 -
YPDAHIRIIGFDNVRQVQCISFIAYKP RBS_STELP 151 4 -
YPQAWIRIIGFDNVRQVQCISFIASKP RBS4_FLAPR 149 4 -
YPQAWIRIIGFDNVRQVQCISFIAYKP RBS1_NICSY 152 4 -
YPQAWVRIIGFDNVRQVQCISFIAYKP RBS1_LYCES 152 4 -
YPNGFIRIIGFDNVRQVQCISFIAYKP RBS1_SOYBN 149 4 -
YPNGFIRIIGFDNVRQVQCISFIAYKP Q42815 149 4 -
YPQAWVRIIGFDNVRQVQCISFIAYKP RBS8_NICPL 151 4 -
YPQAWIRIIGFDNVRQVQCISFIASKP RBS7_FLAPR 144 4 -
YPNAWIRIIGFDNVRQVQCISFIAYKP RBS1_PETSP 151 4 -
YPNGFIRIIGFDNVRQVQCISFIAYKP RBS4_SOYBN 149 4 -
YPQAWIRIIGFDNVRQVQCISFIASKP RBS5_FLAPR 144 4 -
YPEAFTRIIGFDNVRQVQCISFIAYKP RBS2_MESCR 149 4 -
YPQAWIRIIGFDNVRQVQCISFIASKP RBS3_FLAPR 144 4 -
YPNALIRIIGFDNNRQVQCISFIAYKP RBS_RAPSA 149 4 -
YPGAFIRIIGFDNTRQVQCISFIAYKP RBS4_ARATH 149 4 -
YPQAWIRIIGFDNVRQVQCISFIASKP RBS1_FLAPR 144 4 -
YPNAFIRIIGFDNNRQVQCISFIAYKP RBS2_BRANA 149 4 -
YPQAWIRIIGFDNVRQVQCISFIAYKP RBS1_SOLTU 152 4 -
YPGAFIRIIGFDNTRQVQCISFIAYKP RBS3_ARATH 149 4 -
YPGAFIRIIGFDNTRQVQCISFIAYKP RBS2_ARATH 149 4 -
YPQAWIRIIGFDNVRQVQCISFIASKP RBS2_FLAPR 149 4 -
YPEAFIRIIGFDNVRQVQCISFIAYKP RBS3_MESCR 152 4 -
YPEAFIRIIGFDNVRQVQCVSFIAYKP RBS4_MESCR 152 4 -
YPQAWIRIIGFDNVRQVQCIMFIASRP RBS_HELAN 149 4 -
YPNAFIRIIGFDNVRQVQCISFIAYKP RBS_GLYTA 149 4 -
YPNAFIRIIGFDNNRQVQCISFIAYKP Q43746 149 4 -
YPEAFIRIIGFDNVRQVQCISFIAYKP RBS1_MESCR 151 4 -
YPDCYGRIIGFDNVRQVQCISFLAYKP RBS_HEVBR 153 4 -
YPNAFIRIIGFDNVRQVQCISFIAYKP RBS_GOSHI 153 4 -
YPNAFIRIIGFDNNRQVQCISFIAYKP RBS1_BRANA 149 4 -
YPQAWIRIIGFDNVRQVQCISFIASKP RBS6_FLAPR 144 4 -
YPNAFIRIIGFDNTRQVQCISFVAYKP RBS1_ARATH 149 4 -
YPQAWIRIIGFDNVRQVQCISFIAYKP RBS_CAPAN 151 4 -
YPNGFIRIIGFDNVRQVQCISFIAYKP RBS_GLYTO 149 4 -
YPQAWIRIIGFDNVRQVQCVSFIASKP RBS_FLATR 144 4 -
YPSAFIRIIGFDNKRQVQIISFIAYKP RBS_BETVE 153 4 -
YPEAFIRIIGFDNVRQVQCVSFIAYKP RBS6_MESCR 155 4 -
YPTSHIRIIGFDNKRQVQCISFIAYKP RBS_FAGCR 153 4 -
YPDSFIRIIGFDNVRQVQCISFIAHTP RBS_MEDSA 151 4 -
HPDGFIRIIGFDNVRQVQCISFIAYKP Q43874 151 4 -
YPQAFVRIIGFDNVRQVQCISFIAHTP RBS3_PEA 151 4 -
YPQAFVRIIGFDNVRQVQCISFIAHTP RBS2_PEA 151 4 -
YPNAFIRIIGFDSNRQVQCVSFIAYKP O20253 151 4 -
YPNAFIRIIGFDSNRQVQCVSFIAYKP RBS2_SPIOL 151 4 -
YPNAFIRVIGFDNIRQVQCISFIVAKP RBS_LACSA 151 4 -
YPEAFIRIIGFDNVRQVQCVSFIAYKP RBS5_MESCR 151 4 -
HPDGYARIIGFDNVRQVQCISFLAYKP RBS_MANES 153 4 -
YPSAFIRIIGFDNKRQVQCVSFIAYKP RBS_AMAHP 153 4 -
YPEAFIRIIGFDNVRQVQCISFIASTP RBS_TRIRP 149 4 -
YPDAHVRIIGFDNKRQVQCISFIAYKP RBS_SILPR 150 4 -
YPEYFVRIIGFDNKRQVQCISFIAYKP RBS5_LEMGI 150 4 -
YPEYFVRIIGFDNKRQVQCISFIAYKP RBS6_LEMGI 150 4 -
YPDAFIRVIGFDNVRQVQCISFIAYKP RBS_CUCSA 153 4 -
YPAAFIRVIGFDNVRQVQCVSFIVEKP RBS3_FRIAG 152 4 -
YPAAFIRVIGFDNVRQVQCVSFIVEKP RBS2_FRIAG 152 4 -
YPEYFVRIIGFDNKRQVQCISFIAYKP RBS2_LEMGI 150 4 -
YPAAFIRVIGFDNVRQVQCVSFIVERP RBS1_FRIAG 152 4 -
YPAAFIRVIGFDNVRQVQCVSFIVEKP RBS5_FRIAG 152 4 -
YPDAFVRIIGFDNVRQVQLISFIAYKP RBS3_ORYSA 140 4 -
YPDAFVRIIGFDNVRQVQLISFIAYKP Q36688 134 4 -
YPHAFIRIIGFDNNRQVQCISFIAYKP RBS_MUSAC 151 4 -
NPDAFVRIIGFDNVRQVQLISFIAYKP O65105 140 4 -
YPDAFIRIIGFDNVRQVQLISFIAYKP RBS2_ORYSA 140 4 -
YPEYFVRIIGFDNKRQVQCISFIAYKP RBS1_LEMGI 146 4 -
YPDAFVRIIGFDNVRQVQLISLIANKP O22487 140 4 -
YPDAYVRIIGFDNMRQVQCVSFIAFKP RBS_HORVU 139 4 -
YPDAYVRVIGFDNMRQVQCVSFIAFRP RBS2_WHEAT 140 4 -
YPDAFHRVIGFDNVRQTQCVSFIAYKP O24574 140 4 -
YPKAFIRVIGFDNVRQVQCISFIVHKP RBS_PINTH 144 4 -
YPDAYVRVIGFDNLRQVQCVSFIAFRP RBS1_WHEAT 139 4 -
YPDYFNRIIGFDNTRQVQCISFLTYKP RBS_ZANAE 149 4 -
YPEYFVRIIGFDNKRQVQCISFIAYKP RBS4_LEMGI 150 4 -
YPDAFHRVIGFDNIKQTQCVSFIAYKP RBS_MAIZE 140 4 -
YPEYFVRIIGFDNKRQVQCISFIAYKP RBS3_LEMGI 150 4 -
YPNAFIRVIGFDNVRQVQCISFIVHKP RBS_LARLA 160 4 -
YPDPYCRIIGFDNMRQVQSVSFIASKP RBS_AEGSQ 140 4 -
SYPELRAILGFDNIRQTQWLTFIAYKP RBS_SACHY 138 3 -
YPDAFVRIIGFDNVRQVQLISFIAYNP RBS1_ORYSA 138 4 -
YPTAFIRVLGFDAKRQVQVAGFLVKKP Q43110 146 4 -