SPRINT Home UMBER Home Contents Standard Search Advanced Search Relation Search

==SPRINT==> PRINTS View



  selected as


PR00052

Identifier
FIBRILLARIN  [View Relations]  [View Alignment]  
Accession
PR00052
No. of Motifs
7
Creation Date
17-JAN-1995  (UPDATE 07-JUN-1999)
Title
Fibrillarin signature
Database References

PROSITE; PS00566 FIBRILLARIN
BLOCKS; BL00566
PFAM; PF01269 Fibrillarin
INTERPRO; IPR000692
Literature References
1. JANSEN, R.P., HURT, E.C., KERN, H., LEHTONEN, H., CARMO-FONSECA, M.
LAPEYRE, B. AND TOLLERVEY, D.
Evolutionary conservation of the human nucleolar protein fibrillarin and
its functional expression in yeast.
J.CELL BIOL. 113 715-729 (1991).
 
2. GIRARD, J.P., FELIU, J., CAIZERGUES-FERRER, M. AND LAPEYRE, B.
Study of multiple fibrillarinn mRNAs reveals that 3' end formation in 
Scizosaccharomyces pombe is sensitive to cold shock.
NUCLEIC ACIDS RES. 21 1881-1887 (1993).
 
3. SCHIMMANG, T., TOLLERVEY, D., KERN, H., FRANK, R. AND HURT, E.C.
A yeast nucleolar protein related to mammalian fibrillarin is associated
with small nucleolar RNA and is essential for viability.
EMBO J. 8 4015-4024 (1989).

Documentation
Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein
(SnRNP), functioning in vivo in ribosomal RNA processing [1,2]: it is
associated with U3, U8 and U13 small nuclear RNAs in mammals [1] and is
similar to the yeast NOP1 protein [3]. Fibrillarin has a well-conserved
sequence of around 320 amino acids, and contains 3 domains: an N-terminal
Gly/Arg-rich region; a central domain resembling other RNA-binding
proteins and containing an RNP-2-like consensus sequence; and a C-terminal
alpha-helical domain. An evolutionarily related pre-rRNA processing
protein, which lacks the Gly/Arg-rich domain, has been found in various
archaebacteria.
 
FIBRILLARIN is a 7-element fingerprint that provides a signature for 
fibrillarins and fibrillarin-like proteins. The fingerprint was derived
from an initial alignment of 6 sequences: motifs 1-6 were drawn from the
central domain and motif 7 from the C-terminal alpha-helical region -
motif 4 includes the RNP-2-like consensus sequence encoded by PROSITE
pattern FIBRILLARIN (PS00566). Two iterations on OWL25.1 were required to
reach convergence, at which point a true set comprising 10 sequences was
identified.
 
An update on SPTR37_9f identified a true set of 14 sequences, and 1
partial match.
Summary Information
  14 codes involving  7 elements
1 codes involving 6 elements
0 codes involving 5 elements
0 codes involving 4 elements
0 codes involving 3 elements
0 codes involving 2 elements
Composite Feature Index
714141414141414
60111111
50000000
40000000
30000000
20000000
1234567
True Positives
FBRL_CAEEL    FBRL_GIALA    FBRL_HUMAN    FBRL_LEIMA    
FBRL_MOUSE FBRL_SCHPO FBRL_TETTH FBRL_XENLA
FBRL_YEAST FLPA_METJA FLPA_METVA FLPA_METVO
O27283 O57811
True Positive Partials
Codes involving 6 elements
O28192
Sequence Titles
FBRL_CAEEL  FIBRILLARIN - CAENORHABDITIS ELEGANS.         
FBRL_GIALA FIBRILLARIN - GIARDIA LAMBLIA (GIARDIA INTESTINALIS).
FBRL_HUMAN FIBRILLARIN (34 KD NUCLEOLAR SCLERODERMA ANTIGEN) - HOMO SAPIENS (HUMAN).
FBRL_LEIMA FIBRILLARIN - LEISHMANIA MAJOR.
FBRL_MOUSE FIBRILLARIN (NUCLEOLAR PROTEIN 1) - MUS MUSCULUS (MOUSE).
FBRL_SCHPO FIBRILLARIN - SCHIZOSACCHAROMYCES POMBE (FISSION YEAST).
FBRL_TETTH FIBRILLARIN - TETRAHYMENA THERMOPHILA.
FBRL_XENLA FIBRILLARIN - XENOPUS LAEVIS (AFRICAN CLAWED FROG).
FBRL_YEAST FIBRILLARIN (NUCLEOLAR PROTEIN 1) - SACCHAROMYCES CEREVISIAE (BAKER'S YEAST).
FLPA_METJA FIBRILLARIN-LIKE PRE-RRNA PROCESSING PROTEIN - METHANOCOCCUS JANNASCHII.
FLPA_METVA FIBRILLARIN-LIKE PRE-RRNA PROCESSING PROTEIN - METHANOCOCCUS VANNIELII.
FLPA_METVO FIBRILLARIN-LIKE PRE-RRNA PROCESSING PROTEIN - METHANOCOCCUS VOLTAE.
O27283 FIBRILLARIN-LIKE PRE-RRNA PROCESSING PROTEIN - METHANOBACTERIUM THERMOAUTOTROPHICUM.
O57811 227AA LONG HYPOTHETICAL FIBRILLARIN-LIKE PRE-RRNA PROCESSING PROTEIN - PYROCOCCUS HORIKOSHII.

O28192 FIBRILLARIN (FIB) - ARCHAEOGLOBUS FULGIDUS.
Scan History
OWL25_1    2  100  NSINGLE    
SPTR37_9f 2 20 NSINGLE
Initial Motifs
Motif 1  width=20
Element Seqn Id St Int Rpt
LVTKNLVPGESVYGEKRISV FBRL_XENLA 108 108 -
LVTKNLVPGESVYGEKRVSI FBRL_HUMAN 106 106 -
LVTKNMAPGESVYGEKRISV FBRL_YEAST 106 106 -
LVTRNLVPGESVYNEKRISV FBRL_SCHPO 93 93 -
LCTLNMVPGISVYGEKRIEL FBRL_LEIMA 80 80 -
IGTKSLVPNKRVYGEKLVNV FLPA_METVO 23 23 -

Motif 2 width=20
Element Seqn Id St Int Rpt
EYRAWNPFRSKIAAAILGGV FBRL_XENLA 135 7 -
EYRAWNPFRSKLAAAILGGV FBRL_HUMAN 133 7 -
EYRVWNPFRSKLAAGIMGGL FBRL_YEAST 140 14 -
EYRVWNPFRSKLAAGILGGL FBRL_SCHPO 121 8 -
EYRLWNPYRSKLASAIYAGV FBRL_LEIMA 110 10 -
EYRVWNPNKSKLGASIINGL FLPA_METVO 46 3 -

Motif 3 width=22
Element Seqn Id St Int Rpt
GVKVLYLGAASGTTVSHVSDVV FBRL_XENLA 162 7 -
GAKVLYLGAASGTTVSHVSDIV FBRL_HUMAN 160 7 -
GKKVLYLGAASGTSVSHVSDVV FBRL_YEAST 167 7 -
GARVLYLGAANGTSVSHVADVV FBRL_SCHPO 148 7 -
GSKVLYLGGATGTTVSHVSDLV FBRL_LEIMA 137 7 -
GSKVLYLGASAGTTPSHVADVA FLPA_METVO 73 7 -

Motif 4 width=18
Element Seqn Id St Int Rpt
GLVYAVEFSHRSGRDLIN FBRL_XENLA 187 3 -
GLVYAVEFSHRSGRDLIN FBRL_HUMAN 185 3 -
GVVYAVEFSHRPGRELIS FBRL_YEAST 192 3 -
GLVYAVEFSHRSGRDLLN FBRL_SCHPO 173 3 -
GMVYAVEFSHRVGRDLVE FBRL_LEIMA 162 3 -
SPVYAVEFAPRIMREFIE FLPA_METVO 97 2 -

Motif 5 width=30
Element Seqn Id St Int Rpt
IIPVIEDARHPHKYRILVGMVDVVFADVAQ FBRL_XENLA 212 7 -
IIPVIEDARHPHKYRMLIAMVDVIFADVAQ FBRL_HUMAN 210 7 -
IIPIIEDARHPQKYRMLIGMVDCVFADVAQ FBRL_YEAST 217 7 -
VIPIVEDARHVQKYRMLVGMVDVVFADVAQ FBRL_SCHPO 198 7 -
IVPIVEDARYPMKYRMLVPMVDCIFMDVAQ FBRL_LEIMA 186 6 -
LFPILGDANKPEEYANIVEKVDVIFEDVAQ FLPA_METVO 122 7 -

Motif 6 width=30
Element Seqn Id St Int Rpt
PDQTRIVALNAHNFLKNGGHFVISIKANCI FBRL_XENLA 242 0 -
PDQTRIVALNAHTFLRNGGHFVISIKANCI FBRL_HUMAN 240 0 -
PDQARIIALNSHMFLKDQGGVVISIKANCI FBRL_YEAST 247 0 -
PDQARIVALNAAAFLKNEGGVVISVKASCI FBRL_SCHPO 228 0 -
PDQARILALNAQAFLQNGGHYVISIKANCI FBRL_LEIMA 216 0 -
PNQAEILIKNAKWFLKKGGYGMISIKARSV FLPA_METVO 152 0 -

Motif 7 width=22
Element Seqn Id St Int Rpt
KPQEQLTLEPYERDHAVVVGIY FBRL_XENLA 294 22 -
KPQEQLTLEPYERDHAVVVGVY FBRL_HUMAN 292 22 -
KPLEQLTLEPYERDHCIVVGRY FBRL_YEAST 299 22 -
KPQEQLTLEPYERDHCIIVGKY FBRL_SCHPO 280 22 -
KPLEQVSLEPFERDHAVVVGVY FBRL_LEIMA 268 22 -
KIVDAINIEPFEKDHMLFVGIW FLPA_METVO 204 22 -
Final Motifs
Motif 1  width=20
Element Seqn Id St Int Rpt
LVTKNLVPGESVYGEKRISV FBRL_XENLA 108 108 -
LVTKNLVPGESVYGEKRVSI FBRL_HUMAN 106 106 -
LFTKNLVPGESVYGEKRVSI FBRL_MOUSE 112 112 -
LATKNMVVGESVYGEKRVSV FBRL_CAEEL 137 137 -
LVTKNMAPGESVYGEKRISV FBRL_YEAST 106 106 -
LVTRNLVPGESVYNEKRISV FBRL_SCHPO 93 93 -
LCTLNMVPGISVYGEKRIEL FBRL_LEIMA 80 80 -
LVTKNFFPGESVYNEKRMSV FBRL_TETTH 85 85 -
LVTKSLAPGVAVYGEKRISV FBRL_GIALA 115 115 -
IATKSLAPGKRVYGEKLIYS FLPA_METVA 25 25 -
IGTKSLVPNKRVYGEKLVNV FLPA_METVO 23 23 -
IATKSIVKGKKVYDEKIIKI FLPA_METJA 25 25 -
IATKNLVPGQRVYGERVIKW O57811 24 24 -
LLTINPNPGVKVYGERIIDW O27283 20 20 -

Motif 2 width=20
Element Seqn Id St Int Rpt
EYRAWNPFRSKIAAAILGGV FBRL_XENLA 135 7 -
EYRAWNPFRSKLAAAILGGV FBRL_HUMAN 133 7 -
EYRAWNPFRSKLAAAILGGV FBRL_MOUSE 139 7 -
EYRVWNPFRSKLAASIMGGL FBRL_CAEEL 164 7 -
EYRVWNPFRSKLAAGIMGGL FBRL_YEAST 140 14 -
EYRVWNPFRSKLAAGILGGL FBRL_SCHPO 121 8 -
EYRLWNPYRSKLASAIYAGV FBRL_LEIMA 110 10 -
EYRVWNPYRSKIAAAVVGGI FBRL_TETTH 112 7 -
EYREWNPFRSKLGAAVRLNV FBRL_GIALA 142 7 -
EYRIWNPNKSKLGAAIINGL FLPA_METVA 48 3 -
EYRVWNPNKSKLGASIINGL FLPA_METVO 46 3 -
EYRIWNPNKSKLAAAIIKGL FLPA_METJA 48 3 -
EYRIWNPNRSKLGAAIMNGL O57811 47 3 -
EYRVWDPRRSKLAAAILNGL O27283 43 3 -

Motif 3 width=22
Element Seqn Id St Int Rpt
GVKVLYLGAASGTTVSHVSDVV FBRL_XENLA 162 7 -
GAKVLYLGAASGTTVSHVSDIV FBRL_HUMAN 160 7 -
GAKVLYLGAASGTTVSHVSDIV FBRL_MOUSE 166 7 -
GTKLLYLGAASGTTVSHCSDVV FBRL_CAEEL 191 7 -
GKKVLYLGAASGTSVSHVSDVV FBRL_YEAST 167 7 -
GARVLYLGAANGTSVSHVADVV FBRL_SCHPO 148 7 -
GSKVLYLGGATGTTVSHVSDLV FBRL_LEIMA 137 7 -
GSKVLYLGGASGTTVSHVADIV FBRL_TETTH 139 7 -
GAKVLYLGAASGTTVSHVSDIV FBRL_GIALA 169 7 -
GTKVLYLGASAGTTPSHVSDIS FLPA_METVA 75 7 -
GSKVLYLGASAGTTPSHVADVA FLPA_METVO 73 7 -
DSKILYLGASAGTTPSHVADIA FLPA_METJA 75 7 -
GKSVLYLGIASGTTASHVSDIV O57811 74 7 -
DSRVLYLGASAGTTASHISDIV O27283 70 7 -

Motif 4 width=18
Element Seqn Id St Int Rpt
GLVYAVEFSHRSGRDLIN FBRL_XENLA 187 3 -
GLVYAVEFSHRSGRDLIN FBRL_HUMAN 185 3 -
GLVYAVEFSHRSGRDLIN FBRL_MOUSE 191 3 -
GIVYAVEFSHRSGRDLLG FBRL_CAEEL 216 3 -
GVVYAVEFSHRPGRELIS FBRL_YEAST 192 3 -
GLVYAVEFSHRSGRDLLN FBRL_SCHPO 173 3 -
GMVYAVEFSHRVGRDLVE FBRL_LEIMA 162 3 -
GVVYAVEFSHRSGRDLVN FBRL_TETTH 164 3 -
GAVYAVEFSQRSGRDLLE FBRL_GIALA 194 3 -
TIVYAVEFAPRIMREFID FLPA_METVA 99 2 -
SPVYAVEFAPRIMREFIE FLPA_METVO 97 2 -
GIVYAIEYAPRIMRELLD FLPA_METJA 99 2 -
GKIFGIEFSPRVLRELVP O57811 99 3 -
GRVYCIEFSPRMMRELLG O27283 94 2 -

Motif 5 width=30
Element Seqn Id St Int Rpt
IIPVIEDARHPHKYRILVGMVDVVFADVAQ FBRL_XENLA 212 7 -
IIPVIEDARHPHKYRMLIAMVDVIFADVAQ FBRL_HUMAN 210 7 -
IIPVIEDARHPHKYRMLIAMVDVIFADVAQ FBRL_MOUSE 216 7 -
VVPIVEDARHPHKYRMLVGMVDVIFSDVAQ FBRL_CAEEL 241 7 -
IIPIIEDARHPQKYRMLIGMVDCVFADVAQ FBRL_YEAST 217 7 -
VIPIVEDARHVQKYRMLVGMVDVVFADVAQ FBRL_SCHPO 198 7 -
IVPIVEDARYPMKYRMLVPMVDCIFMDVAQ FBRL_LEIMA 186 6 -
VVPIIGDARKPQEYRFLVGMVDVVFADVAQ FBRL_TETTH 189 7 -
VYPIIADARHPYKYRMIVPEVDCIFSDVAQ FBRL_GIALA 219 7 -
LIPILGDANRPFEYSNIVGKVDVIFEDVAQ FLPA_METVA 124 7 -
LFPILGDANKPEEYANIVEKVDVIFEDVAQ FLPA_METVO 122 7 -
IIPILGDANKPQEYANIVEKVDVIYEDVAQ FLPA_METJA 124 7 -
IVPILGDATKPEEYRALVPKVDVIFEDVAQ O57811 124 7 -
MAPLLEDASRPLSYLRMVEAADLVYCDVAQ O27283 119 7 -

Motif 6 width=30
Element Seqn Id St Int Rpt
PDQTRIVALNAHNFLKNGGHFVISIKANCI FBRL_XENLA 242 0 -
PDQTRIVALNAHTFLRNGGHFVISIKANCI FBRL_HUMAN 240 0 -
PDQTRIVALNAHTFLRNGGHFVISIKANCI FBRL_MOUSE 246 0 -
PDQARIVALNAQNFLRNGGHAVISIKANCI FBRL_CAEEL 271 0 -
PDQARIIALNSHMFLKDQGGVVISIKANCI FBRL_YEAST 247 0 -
PDQARIVALNAAAFLKNEGGVVISVKASCI FBRL_SCHPO 228 0 -
PDQARILALNAQAFLQNGGHYVISIKANCI FBRL_LEIMA 216 0 -
PDQARIMGMNCLYFLKNGGHFLISIKACCI FBRL_TETTH 219 0 -
PDQARIVAENARYYLKANGGMLISIKASSV FBRL_GIALA 249 0 -
PNQAEILVKNAKWFLNKDGYAMISIKARSI FLPA_METVA 154 0 -
PNQAEILIKNAKWFLKKGGYGMISIKARSV FLPA_METVO 152 0 -
PNQAEILIKNAKWFLKKGGYGMIAIKARSI FLPA_METJA 154 0 -
PTQAKILIDNAEVYLKRGGYGMIAVKSRSI O57811 154 0 -
PDQTRLFIENMDCFLKRDGYGLIMIKARSI O27283 149 0 -

Motif 7 width=22
Element Seqn Id St Int Rpt
KPQEQLTLEPYERDHAVVVGIY FBRL_XENLA 294 22 -
KPQEQLTLEPYERDHAVVVGVY FBRL_HUMAN 292 22 -
KPQEQLTLEPYERDHAVVVGVY FBRL_MOUSE 298 22 -
KPLEQVTLEPYERDHAVVVAVY FBRL_CAEEL 323 22 -
KPLEQLTLEPYERDHCIVVGRY FBRL_YEAST 299 22 -
KPQEQLTLEPYERDHCIIVGKY FBRL_SCHPO 280 22 -
KPLEQVSLEPFERDHAVVVGVY FBRL_LEIMA 268 22 -
KPELLLTLEPYERDHAMVLGSY FBRL_TETTH 271 22 -
KCKEQLDIGEFHRNHAIVVGRF FBRL_GIALA 301 22 -
DIVDEINIEPFEKDHIMFVGIW FLPA_METVA 206 22 -
KIVDAINIEPFEKDHMLFVGIW FLPA_METVO 204 22 -
KIVDEVDIEPFEKDHVMFVGIW FLPA_METJA 206 22 -
EVIERLNLEPYEKDHALFVVRK O57811 205 21 -
RIIDQVGLNPYEKDHMAVLVKR O27283 201 22 -