SPRINT Home UMBER Home Contents Standard Search Advanced Search Relation Search

==SPRINT==> PRINTS View



  selected as


PR01741

Identifier
SEPTIN3  [View Relations]  [View Alignment]  
Accession
PR01741
No. of Motifs
3
Creation Date
27-JUN-2002
Title
Septin 3 signature
Database References
Literature References
1. HARTWELL, L.
Genetic control of the cell division cycle in yeast. IV. Genes controlling 
bud emergence and cytokinesis.
EXP.CELL RES. 69 265-276 (1971).
 
2. HAARER, B. AND PRINGLE, J.
Immunofluorescence localization of the Saccharomyces cerevisiae CDC12 gene 
product to the vicinity of the 10-nm filaments in the mother-bud neck.
MOL.CELL BIOL. 7 3678-3687 (1987).
 
3. LONGTINE, M., THEESFELD, C., MCMILLAN, J., WEAVER, E., PRINGLE, J.
AND LEW, D.
Septin-dependent assembly of a cell cycle-regulatory module in 
Saccharomyces cerevisiae. 
MOL.CELL BIOL. 20 4049-4061 (2000).
 
4. FIELD, C. AND KELLOG, D.
Septins: cytoskeletal polymers or signalling GTPases? 
TRENDS CELL BIOL. 9 387-394 (1999).
 
5. BEITES, C., XIE, H., BOWSER, R. AND TRIMBLE, W.
The septin CDCrel-1 binds syntaxin and inhibits exocytosis.
NAT.NEUROSCI. 2 434-439. (1999).
 
6. KINOSHITA, M. AND NODA, M.
Roles of septins in the mammalian cytokinesis machinery.
CELL STRUCT.FUNCT. 26 667-670 (2001).
 
7. XUE, J., WANG, X., MALLADI, C., KINOSHITA, M., MILBURN, P., LENGYEL, I, 
ROSTAS, J. AND ROBINSON, P.
Phosphorylation of a new brain-specific septin, G-septin, by cGMP-dependent 
protein kinase.
J.BIOL.CHEM. 275 10047-10056 (2000).

Documentation
Septins constitute a eukaryotic family of guanine nucleotide-binding proteins.
Members of the family were first identified by genetic screening for 
Saccharomyces cerevisiae mutants defective in cytokinesis [1]. Temperature-
sensitive mutations in four genes, CDC3, CDC10, CDC11 and CDC12, were found
to cause cell-cycle arrest and defects in bud growth and cytokinesis. The
protein products of these genes localise at the division plane between
mother and daughter cells, indicating a role in mother-daughter separation
during cytokinesis [2]. Members of the family were therefore termed septins
to reflect their role in septation and cell division. The identification of
septin homologues in higher eukaryotes, which localise to the cleavage
furrow in dividing cells, supports an orthologous function in cytokinesis.
Septins have since been identified in most eukaryotes, except plants [3].
 
Septins are approximately 40-50kDa in molecular mass, and typically comprise
a conserved central core domain (>35% sequence identity between mammalian
and yeast homologues) flanked by more divergent N- and C-termini. Most
septins possess a P-loop motif in their N-terminal domain (which is
characteristic of GTP-binding proteins), and a predicted C-terminal coiled-
coil domain [4].
 
A number of septin interaction partners have been identified in yeast, 
many of which are components of the budding site selection machinery, kinase
cascades or of the ubiquitination pathway [3,4]. It has therefore been 
proposed that septins may act as a scaffold that provides an interaction 
matrix for other proteins. In mammals, septins have been shown to interact
regulate vesicle dynamics [5]. Mammalian septins have also been implicated
in a variety of other cellular processes, including apoptosis, carcinogenesis
and neurodegeneration [6].
 
Septin 3 has been cloned in humans and mice. A rat orthologue has also been
identified, termed G-septin, which shares 95% overall sequence identity with
mouse septin 3. Northern blotting studies indicate that septin 3 expression
is high in the brain but undetectable in other tissues, suggesting that the
protein is primarily neuronal [7].
 
SEPTIN3 is a 3-element fingerprint that provides a signature for septin 3
proteins. The fingerprint was derived from an initial alignment of 2 
sequences: the motifs were drawn from conserved regions spanning virtually
the full alignment length, focusing on those sections that characterise 
septin 3 but distinguish it from other family members - motif 1 lies in
the N-terminal region prior to the GTP binding site; and motifs 2 and 3
reside in the C-terminal third of the alignment. Two iterations on 
SPTR40_20f were required to reach convergence, at which point a true set 
comprising 3 sequences was identified. 
Summary Information
3 codes involving  3 elements
0 codes involving 2 elements
Composite Feature Index
3333
2000
123
True Positives
Q9WU34        SEP3_HUMAN    SEP3_MOUSE    
Sequence Titles
Q9WU34      G-SEPTIN ALPHA - Rattus norvegicus (Rat).     
SEP3_HUMAN Neuronal-specific septin 3 - Homo sapiens (Human).
SEP3_MOUSE Neuronal-specific septin 3 - Mus musculus (Mouse).
Scan History
SPTR40_20f 2  200  NSINGLE    
Initial Motifs
Motif 1  width=30
Element Seqn Id St Int Rpt
MSELVPEPRPKPAVPMKPVSINSNLLGYIG SEP3_MOUSE 1 1 -
MSELVPEPRPKPAVPMKPMSINSNLLGYIG SEP3_HUMAN 1 1 -

Motif 2 width=23
Element Seqn Id St Int Rpt
KEFDEDLEDKTENDKIRQESMPF SEP3_MOUSE 217 186 -
KEFDEDLEDKTENDKIRQESMPF SEP3_HUMAN 226 195 -

Motif 3 width=17
Element Seqn Id St Int Rpt
YETYRAKRLNDNGGLPP SEP3_MOUSE 299 59 -
YETYRAKRLNDNGGLPP SEP3_HUMAN 308 59 -
Final Motifs
Motif 1  width=30
Element Seqn Id St Int Rpt
MSELVPEPRPKPAVPMKPVSINSNLLGYIG SEP3_MOUSE 1 1 -
MSELVPEPRPKPAVPMKPVSINSNLLGCIG Q9WU34 14 14 -
MSELVPEPRPKPAVPMKPMSINSNLLGYIG SEP3_HUMAN 1 1 -

Motif 2 width=23
Element Seqn Id St Int Rpt
KEFDEDLEDKTENDKIRQESMPF SEP3_MOUSE 217 186 -
KEFDEDLEDKTENDKIRQESMPF Q9WU34 239 195 -
KEFDEDLEDKTENDKIRQESMPF SEP3_HUMAN 226 195 -

Motif 3 width=17
Element Seqn Id St Int Rpt
YETYRAKRLNDNGGLPP SEP3_MOUSE 299 59 -
YETYRAKRLNDNGGLPP Q9WU34 321 59 -
YETYRAKRLNDNGGLPP SEP3_HUMAN 308 59 -