SPRINT Home UMBER Home Contents Standard Search Advanced Search Relation Search

==SPRINT==> PRINTS View



  selected as


PR01576

Identifier
PDEFORMYLASE  [View Relations]  [View Alignment]  
Accession
PR01576
No. of Motifs
4
Creation Date
19-SEP-2001
Title
Peptide deformylase signature
Database References

PFAM; PF01327 Pep_deformylase
PRODOM; PD003844 Pep_de
INTERPRO; IPR000181 Pep_d
PDB; 2DEF; 1BSK
SCOP; 2DEF; 1BSK
CATH; 2DEF; 1BSK
Literature References
1. BECKER, A., SCHLICHTING, I., KABSCH, W., SCHULTZ, S. AND WAGNER, A.F.
Structure of peptide deformylase and identification of the substrate
binding site.
J.BIOL.CHEM. 273 11413-11416 (1998). 
 
2. BECKER, A., SCHLICHTING, I., KABSCH, W., GROCHE, D., SCHULTZ, S.
AND WAGNER, A.F.
Iron center, substrate recognition and mechanism of peptide deformylase.
NAT.STRUCT.BIOL. 5 1053-1058 (1998). 
 
3. MEINNEL, T., BLANQUET, S. AND DARDEL, F.
A new subclass of the zinc metalloproteases superfamily revealed by the
solution structure of peptide deformylase.
J.MOL.BIOL. 262 375-386 (1996). 

Documentation
Peptide deformylase (PDF) is an essential metalloenzyme required for the 
removal of the formyl group at the N-terminus of nascent polypeptide chains
in eubacteria [1]. The enzyme acts as a monomer and binds a single zinc ion,
catalysing the reaction:
 
	N-FORMYL-L-METHIONINE + H(2)O = FORMATE + L-METHIONINE
 
Catalytic efficiency strongly depends on the identity of the bound metal [2]. 
 
PDF, a member of the zinc metalloproteases family, comprises an active core
domain of 147 residues and a C-terminal tail of 21 residues [3]. The 3D fold
of the catalytic core has been determined by X-ray crystallography and NMR
[1-3]. Overall, the structure contains a series of anti-parallel beta-
strands that surround two perpendicular alpha-helices [3]. The C-terminal 
helix contains the characteristic HEXXH motif of metalloenzymes, which is
crucial for activity. The helical arrangement, and the way the histidine
residues bind the zinc ion, is reminiscent of other metalloproteases, such
as thermolysin or metzincins. However, the arrangement of secondary and
tertiary structures of PDF, and the positioning of its third zinc ligand (a
cysteine residue), are quite different. These discrepancies, together with 
notable biochemical differences, suggest that PDF constitutes a new class of
zinc-metalloproteases [3].
 
PDEFORMYLASE is a 4-element fingerprint that provides a signature for
peptide deformylases. The fingerprint was derived from an initial alignment
of 11 sequences: the motifs were drawn from conserved regions spanning 
virtually the full alignment length - motif 1 spans the C-terminal two-
thirds of alpha-helix 2 and beta-strands 1 and 2; motif 2 contains the metal-
binding cysteine residue; motif 3 includes strand 5; and motif 4 spans
strand 6 and helix 3, which contains two metal-binding histidine residues.
Seven iterations on SPTR39.22_17.3f were required to reach convergence, at
which point a true set comprising 54 sequences was identified. Several 
partial matches were also found, all of which are putative deformylases that
fail to match one or more motifs.
Summary Information
  54 codes involving  4 elements
3 codes involving 3 elements
5 codes involving 2 elements
Composite Feature Index
454545454
33231
22143
1234
True Positives
DEF2_BACST    DEF2_BACSU    DEF_AQUAE     DEF_BACSU     
DEF_BORBU DEF_BUCAI DEF_CHLMU DEF_CHLPN
DEF_CHLTR DEF_CLOAB DEF_ECOLI DEF_FREDI
DEF_HAEIN DEF_HELPJ DEF_HELPY DEF_LACLA
DEF_MYCGE DEF_MYCPN DEF_MYCTU DEF_PASMU
DEF_RICPR DEF_STRCO DEF_SYNY3 DEF_THEMA
DEF_THETH DEF_TREPA Q99XY7 Q9ABF5
Q9CBI2 Q9F2F0 Q9F4L4 Q9FCA2
Q9FUZ0 Q9FUZ2 Q9FV53 Q9FV54
Q9HBH1 Q9I7A8 Q9JQN0 Q9K4A0
Q9K9I9 Q9KN16 Q9KVU3 Q9KX63
Q9LYJ4 Q9PEV2 Q9PIT8 Q9PQ25
Q9RD27 Q9REQ2 Q9RRQ4 Q9VGY2
Q9XI30 Q9ZAW6
True Positive Partials
Codes involving 3 elements
O88094 Q99UQ3 Q9JN24
Codes involving 2 elements
DEF_CLOBE Q9GU93 Q9I4L3 Q9U112
Q9VNF2
Sequence Titles
DEF2_BACST  POLYPEPTIDE DEFORMYLASE 2 (EC 3.5.1.31) (PDF 2) (FORMYLMETHIONINE DEFORMYLASE 2) - Bacillus stearothermophilus. 
DEF2_BACSU POLYPEPTIDE DEFORMYLASE 2 (EC 3.5.1.31) (PDF 2) (FORMYLMETHIONINE DEFORMYLASE 2) - Bacillus subtilis.
DEF_AQUAE POLYPEPTIDE DEFORMYLASE (EC 3.5.1.31) (PDF) (FORMYLMETHIONINE DEFORMYLASE) - Aquifex aeolicus.
DEF_BACSU POLYPEPTIDE DEFORMYLASE (EC 3.5.1.31) (PDF) (FORMYLMETHIONINE DEFORMYLASE) - Bacillus subtilis.
DEF_BORBU POLYPEPTIDE DEFORMYLASE (EC 3.5.1.31) (PDF) (FORMYLMETHIONINE DEFORMYLASE) - Borrelia burgdorferi (Lyme disease spirochete).
DEF_BUCAI POLYPEPTIDE DEFORMYLASE (EC 3.5.1.31) (PDF) (FORMYLMETHIONINE DEFORMYLASE) - Buchnera aphidicola (subsp. Acyrthosiphon pisum) (Acyrthosiphon pisum symbiotic bacterium).
DEF_CHLMU POLYPEPTIDE DEFORMYLASE (EC 3.5.1.31) (PDF) (FORMYLMETHIONINE DEFORMYLASE) - Chlamydia muridarum.
DEF_CHLPN POLYPEPTIDE DEFORMYLASE (EC 3.5.1.31) (PDF) (FORMYLMETHIONINE DEFORMYLASE) - Chlamydia pneumoniae (Chlamydophila pneumoniae).
DEF_CHLTR POLYPEPTIDE DEFORMYLASE (EC 3.5.1.31) (PDF) (FORMYLMETHIONINE DEFORMYLASE) - Chlamydia trachomatis.
DEF_CLOAB POLYPEPTIDE DEFORMYLASE (EC 3.5.1.31) (PDF) (FORMYLMETHIONINE DEFORMYLASE) - Clostridium acetobutylicum.
DEF_ECOLI POLYPEPTIDE DEFORMYLASE (EC 3.5.1.31) (PDF) (FORMYLMETHIONINE DEFORMYLASE) - Escherichia coli.
DEF_FREDI POLYPEPTIDE DEFORMYLASE (EC 3.5.1.31) (PDF) (FORMYLMETHIONINE DEFORMYLASE) - Fremyella diplosiphon (Calothrix PCC 7601).
DEF_HAEIN POLYPEPTIDE DEFORMYLASE (EC 3.5.1.31) (PDF) (FORMYLMETHIONINE DEFORMYLASE) - Haemophilus influenzae.
DEF_HELPJ POLYPEPTIDE DEFORMYLASE (EC 3.5.1.31) (PDF) (FORMYLMETHIONINE DEFORMYLASE) - Helicobacter pylori J99 (Campylobacter pylori J99).
DEF_HELPY POLYPEPTIDE DEFORMYLASE (EC 3.5.1.31) (PDF) (FORMYLMETHIONINE DEFORMYLASE) - Helicobacter pylori (Campylobacter pylori).
DEF_LACLA POLYPEPTIDE DEFORMYLASE (EC 3.5.1.31) (PDF) (FORMYLMETHIONINE DEFORMYLASE) - Lactococcus lactis (subsp. lactis) (Streptococcus lactis).
DEF_MYCGE POLYPEPTIDE DEFORMYLASE (EC 3.5.1.31) (PDF) (FORMYLMETHIONINE DEFORMYLASE) - Mycoplasma genitalium.
DEF_MYCPN POLYPEPTIDE DEFORMYLASE (EC 3.5.1.31) (PDF) (FORMYLMETHIONINE DEFORMYLASE) - Mycoplasma pneumoniae.
DEF_MYCTU POLYPEPTIDE DEFORMYLASE (EC 3.5.1.31) (PDF) (FORMYLMETHIONINE DEFORMYLASE) - Mycobacterium tuberculosis.
DEF_PASMU POLYPEPTIDE DEFORMYLASE (EC 3.5.1.31) (PDF) (FORMYLMETHIONINE DEFORMYLASE) - Pasteurella multocida.
DEF_RICPR POLYPEPTIDE DEFORMYLASE (EC 3.5.1.31) (PDF) (FORMYLMETHIONINE DEFORMYLASE) - Rickettsia prowazekii.
DEF_STRCO POLYPEPTIDE DEFORMYLASE (EC 3.5.1.31) (PDF) (FORMYLMETHIONINE DEFORMYLASE) - Streptomyces coelicolor.
DEF_SYNY3 POLYPEPTIDE DEFORMYLASE (EC 3.5.1.31) (PDF) (FORMYLMETHIONINE DEFORMYLASE) - Synechocystis sp. (strain PCC 6803).
DEF_THEMA POLYPEPTIDE DEFORMYLASE (EC 3.5.1.31) (PDF) (FORMYLMETHIONINE DEFORMYLASE) - Thermotoga maritima.
DEF_THETH POLYPEPTIDE DEFORMYLASE (EC 3.5.1.31) (PDF) (FORMYLMETHIONINE DEFORMYLASE) - Thermus aquaticus (subsp. thermophilus).
DEF_TREPA POLYPEPTIDE DEFORMYLASE (EC 3.5.1.31) (PDF) (FORMYLMETHIONINE DEFORMYLASE) - Treponema pallidum.
Q99XY7 PUTATIVE POLYPEPTIDE DEFORMYLASE - Streptococcus pyogenes.
Q9ABF5 POLYPEPTIDE DEFORMYLASE - Caulobacter crescentus.
Q9CBI2 POLYPEPTIDE DEFORMYLASE - Mycobacterium leprae.
Q9F2F0 POLYPEPTIDE DEFORMYLASE (EC 3.5.1.31) - Streptococcus pneumoniae.
Q9F4L4 PEPTIDE DEFORMYLASE PDF1 (PDF1 PROTEIN) - Staphylococcus aureus, and Staphylococcus aureus subsp. aureus N315.
Q9FCA2 PUTATIVE POLYPEPTIDE DEFORMYLASE - Streptomyces coelicolor.
Q9FUZ0 PEPTIDE DEFORMYLASE-LIKE PROTEIN - Lycopersicon esculentum (Tomato).
Q9FUZ2 PEPTIDE DEFORMYLASE - Arabidopsis thaliana (Mouse-ear cress).
Q9FV53 PEPTIDE DEFORMYLASE-LIKE PROTEIN - Arabidopsis thaliana (Mouse-ear cress).
Q9FV54 PEPTIDE DEFORMYLASE-LIKE PROTEIN - Lycopersicon esculentum (Tomato).
Q9HBH1 PEPTIDE DEFORMYLASE-LIKE PROTEIN (POLYPEPTIDE DEFORMYLASE-LIKE PROTEIN) - Homo sapiens (Human).
Q9I7A8 POLYPEPTIDE DEFORMYLASE - Pseudomonas aeruginosa.
Q9JQN0 POLYPEPTIDE DEFORMYLASE (EC 3.5.1.31) - Neisseria meningitidis (serogroup A), and Neisseria meningitidis (serogroup B).
Q9K4A0 PUTATIVE POLYPEPTIDE DEFORMYLASE - Streptomyces coelicolor.
Q9K9I9 FORMYLMETHIONINE DEFORMYLASE - Bacillus halodurans.
Q9KN16 POLYPEPTIDE DEFORMYLASE - Vibrio cholerae.
Q9KVU3 POLYPEPTIDE DEFORMYLASE - Vibrio cholerae.
Q9KX63 POLYPEPTIDE DEFORMYLASE (EC 3.5.1.31) - Mycoplasma gallisepticum.
Q9LYJ4 HYPOTHETICAL 30.6 KDA PROTEIN - Arabidopsis thaliana (Mouse-ear cress).
Q9PEV2 POLYPEPTIDE DEFORMYLASE - Xylella fastidiosa.
Q9PIT8 POLYPEPTIDE DEFORMYLASE (EC 3.5.1.31) - Campylobacter jejuni.
Q9PQ25 POLYPEPTIDE DEFORMYLASE - Ureaplasma parvum (Ureaplasma urealyticum biotype 1).
Q9RD27 POLYPEPTIDE DEFORMYLASE - Streptomyces coelicolor.
Q9REQ2 POLYPEPTIDE DEFORMYLASE - Zymomonas mobilis.
Q9RRQ4 POLYPEPTIDE DEFORMYLASE - Deinococcus radiodurans.
Q9VGY2 CG6482 PROTEIN - Drosophila melanogaster (Fruit fly).
Q9XI30 F9L1.34 PROTEIN (AT1G15390/F9L1_34) - Arabidopsis thaliana (Mouse-ear cress).
Q9ZAW6 N-FORMYLMETHIONYLAMINOACYL-TRNA DEFORMYLASE - Helicobacter pylori (Campylobacter pylori).

O88094 HYPOTHETICAL 16.8 KDA PROTEIN - Escherichia coli.
Q99UQ3 SA1058 PROTEIN - Staphylococcus aureus subsp. aureus N315.
Q9JN24 HYPOTHETICAL 16.9 KDA PROTEIN - Escherichia coli.

DEF_CLOBE POLYPEPTIDE DEFORMYLASE (EC 3.5.1.31) (PDF) (FORMYLMETHIONINE DEFORMYLASE) - Clostridium beijerinckii (Clostridium MP).
Q9GU93 ORF260 - Trypanosoma brucei.
Q9I4L3 PROBABLE PEPTIDE DEFORMYLASE - Pseudomonas aeruginosa.
Q9U112 HYPOTHETICAL 55.1 KDA PROTEIN - Leishmania major.
Q9VNF2 CG11005 PROTEIN - Drosophila melanogaster (Fruit fly).
Scan History
SPTR39.22_17.3f 7  200  NSINGLE    
Initial Motifs
Motif 1  width=30
Element Seqn Id St Int Rpt
DDMFDTMYQEKGIGLAAPQVDILQRIITID DEF_HAEIN 33 33 -
DDMFETMYAEEGIGLAATQVDIHQRIIVID DEF_ECOLI 32 32 -
DDMHETMIASEGIGLAAIQVGLPLRMLIIN DEF_HELPY 33 33 -
DDMFETMYNADGVGLAAPQVGILKRLVVID DEF_CLOAB 33 33 -
EDMLETMFEAKGVGLAAPQIGLSQRLFVAV DEF_THETH 31 31 -
RDMLQTMYSKDGIGLAAPQVGIHKQLIVID DEF_FREDI 46 46 -
DDMYDTMLEMDGVGLAAPQIGILKRAAVVE DEF_BACSU 33 33 -
KEMLQTMYSANGIGLAAPQVGINKQLLVVD DEF_SYNY3 46 46 -
ERMIETMYHYDGVGLAAPQVGISQRFFVMD DEF_THEMA 31 31 -
NGDAEKYGIIPGIGIAANQIGYWKQMFYIH DEF_MYCPN 72 72 -
DGKAQEYDIIPGIGIAANQIGYWKQLFYIH DEF_MYCGE 72 72 -

Motif 2 width=12
Element Seqn Id St Int Rpt
EGCLSIPGFRAL DEF_HAEIN 89 26 -
EGCLSIPEQRAL DEF_ECOLI 88 26 -
EGCLSVPGFYEE DEF_HELPY 94 31 -
EGCLSIPERQGE DEF_CLOAB 86 23 -
EGCLSLPGLYSE DEF_THETH 100 39 -
EGCLSIPNVYMD DEF_FREDI 105 29 -
EGCLSFPNVYGD DEF_BACSU 88 25 -
EGCLSVPNVYMD DEF_SYNY3 105 29 -
EGCLSFPEIFVE DEF_THEMA 85 24 -
EGCLSVPKMHQG DEF_MYCPN 132 30 -
EGCLSVKKQHKG DEF_MYCGE 132 30 -

Motif 3 width=19
Element Seqn Id St Int Rpt
VPRKEKVTVRALDRDGKEF DEF_HAEIN 101 0 -
VPRAEKVKIRALDRDGKPF DEF_ECOLI 100 0 -
VERFEKVKIEYQNRFAEVK DEF_HELPY 106 0 -
VERPTYVKAKALNEKGEEI DEF_CLOAB 98 0 -
VPRAERIRVEYQDEEGRGR DEF_THETH 113 1 -
VKRPEVVEIAYKDENGRPK DEF_FREDI 117 0 -
VTRADYVKVRAFNRQGKPF DEF_BACSU 100 0 -
VTRPRAIEVTYKDEHGRPQ DEF_SYNY3 117 0 -
IERSKRIKVKYQNTRGEYV DEF_THEMA 97 0 -
VIRHEWITITGFDWLQQKE DEF_MYCPN 145 1 -
VIRSEWITIKGYDWFEKKE DEF_MYCGE 145 1 -

Motif 4 width=30
Element Seqn Id St Int Rpt
TLDADGLLAICIQHEIDHLNGILFVDYLSP DEF_HAEIN 120 0 -
ELEADGLLAICIQHEMDHLVGKLFMDYLSP DEF_ECOLI 119 0 -
VLEASELLAVAIQHEIDHLNGVLFVDKLSI DEF_HELPY 125 0 -
VIEAEDLFARAICHETDHLNGVLFVDKLAE DEF_CLOAB 117 0 -
VLELEGYMARVFQHEIDHLDGILFFERLPK DEF_THETH 132 0 -
TLKATDLLARCIQHEMDHLNGVVFVDRVDN DEF_FREDI 136 0 -
ILEARGFLARAVQHEMDHLDGVLFTSKISK DEF_BACSU 119 0 -
KRLFAELTARVIQHEMDHLNGVMFVDRVDN DEF_SYNY3 136 0 -
EEELEGYAARVFQHEFDHLNGVLIIDRISP DEF_THEMA 116 0 -
TITATGLFGMCLQHEFDHLQGRFYYHRINP DEF_MYCPN 165 1 -
TIKATGLFGMCLQHEFDHLQGRFFYQRINP DEF_MYCGE 165 1 -
Final Motifs
Motif 1  width=30
Element Seqn Id St Int Rpt
DDMFDTMYQEKGIGLAAPQVDILQRIITID DEF_HAEIN 33 33 -
DDMFETMYEAPGIGLAATQVNVHKRIVVMD Q9I7A8 33 33 -
DDMFETMYAEEGIGLAATQVDIHQRIIVID DEF_ECOLI 32 32 -
DDMLETMYAEEGIGLAATQVDIHQRIVVID Q9KVU3 33 33 -
DDMFETMYAAPGIGLAATQVNVHQRFMVID Q9PEV2 36 36 -
DNMFETMYLEEGIGLAATQVNIHQRIITID DEF_PASMU 33 33 -
ADMFETMYESRGIGLAATQVDVHERVVVMD Q9JQN0 33 33 -
DDMYETMIASEGIGLAAIQVGLPLRMLIIN Q9ZAW6 33 33 -
DDMLETMYDAPGIGLAAVQVGEPVRVIVMD Q9ABF5 37 37 -
DDMHETMIASEGIGLAAIQVGLPLRMLIIN DEF_HELPY 33 33 -
DDMHETMIASEGIGLAAIQVGLPLRMLIIN DEF_HELPJ 33 33 -
DDMFETMYNADGVGLAAPQVGILKRLVVID DEF_CLOAB 33 33 -
RDMFDTMYEAEGVGLAANQIGVPLSVMVID DEF_AQUAE 32 32 -
DDMIKVMRLAPGVGLAAPQIGVPLRIIVLE Q9FV53 113 113 -
DDMIKVMRLAPGVGLAAPQIGVPLRIIVLE Q9XI30 103 103 -
DDMFETMYKAPGIGLAAIQVGVAKRLLVID Q9REQ2 33 33 -
DTMLETMFEERGVGLAAPQIGLPVRMFVAV Q9RRQ4 60 60 -
EDMLETMFEAKGVGLAAPQIGLSQRLFVAV DEF_THETH 31 31 -
RDMLQTMYSKDGIGLAAPQVGIHKQLIVID DEF_FREDI 46 46 -
EEMVKVMRNAPGVGLAAPQIGIPLKIIVLE Q9FUZ0 121 121 -
DDMYDTMLEMDGVGLAAPQIGILKRAAVVE DEF_BACSU 33 33 -
DAMFDVMYKTDGIGLSAPQVGLNVQLMVFN Q9FUZ2 110 110 -
DAMFDVMYKTDGIGLSAPQVGLNVQLMVFN Q9LYJ4 110 110 -
SGMFRVMRGAGGVGLAAPQVGRTVRVFVVD DEF_TREPA 30 30 -
SDMCDTMEAHRGVGLAAPQVGKNVSLFVMC DEF_CHLPN 32 32 -
LDMSETMTFYKGVGLAAPQVGHSVALFIMG DEF_CHLMU 32 32 -
DDMFRTMYVAEGAGLAANQVGVDLRLFVYD DEF_STRCO 56 56 -
DLLDTLYATDNGIGLAAPQVGREEAIVVID Q9KN16 33 33 -
KEMLQTMYSANGIGLAAPQVGINKQLLVVD DEF_SYNY3 46 46 -
LDMSETMAFYKGVGLAAPQVGQSISLFIMG DEF_CHLTR 32 32 -
DDMYETMIASNGVGLAAIQVDIPLRVLLVN Q9PIT8 32 32 -
HDMLETMYNADGAGLAAVQVGILLRILVID DEF_RICPR 33 33 -
ERMIETMYHYDGVGLAAPQVGISQRFFVMD DEF_THEMA 31 31 -
DEMFDIMYKTDGIGLSAPQVGMNVQLMVFN Q9FV54 116 116 -
EALRLTMHAAPGVGLAAPQVGVGLRVAVIE Q9RD27 55 55 -
ATMYDTMDAANGVGLAANQIGCSLRLFVYD DEF_MYCTU 38 38 -
PVMAEKLGLRAGVGLAAPQIDVSKRIIAVL Q99XY7 59 59 -
ADMFASQRTAEGVGLAANQIGVSKKVFVYD Q9K4A0 71 71 -
STMYDTMDAAHGVGLAANQIGYGLRVFVYD Q9CBI2 38 38 -
KKMIELMDISGGVGLAAPQVGLDLALFVVR DEF_BORBU 37 37 -
PVMAEKMGLRGGVGLAAPQLDISKRIIAVL Q9F2F0 59 59 -
PELAAKYGLRPGIGLAAPQINVSKRMIAVH DEF2_BACST 47 47 -
EDLFATMYAAHGVGLAANQVGEAVRVFVYD Q9FCA2 81 81 -
NDMIDTMYQEEGIGLAATQVNIPLQIIVVN DEF_BUCAI 33 33 -
PVMAEKMGLRGGVGLAANQLGLLKKVIAVL DEF_LACLA 47 47 -
PEIAEKYSLRPGVGLAAPQIGLSKQMIAVH Q9K9I9 47 47 -
EEIAKRYGLRSGVGLAAPQINISKRMIAVL Q9F4L4 47 47 -
PELAEKYKLRPGVGLAAPQINIKKRMIAVH DEF2_BACSU 47 47 -
DGMVKVLRHYDCVGVAAPQVGIPLRIIVME Q9VGY2 39 39 -
DDNAEKYDIRPGIGIAANQLGLNQRFFYVH Q9KX63 59 59 -
QRLVQVMRRRRCVGLSAPQLGVPRQVLALE Q9HBH1 97 97 -
NGDAEKYGIIPGIGIAANQIGYWKQMFYIH DEF_MYCPN 72 72 -
HNQAKKYKIRSGIAIAANQVGWNKRATYIH Q9PQ25 61 61 -
DGKAQEYDIIPGIGIAANQIGYWKQLFYIH DEF_MYCGE 72 72 -

Motif 2 width=12
Element Seqn Id St Int Rpt
EGCLSIPGFRAL DEF_HAEIN 89 26 -
EGCLSVPGFYEN Q9I7A8 90 27 -
EGCLSIPEQRAL DEF_ECOLI 88 26 -
EGCLSVPGARAL Q9KVU3 89 26 -
EGCLSVPGIHAD Q9PEV2 92 26 -
EGCLSLPGFRGF DEF_PASMU 89 26 -
EGCLSVPGIYDT Q9JQN0 89 26 -
EGCLSVPGFYEE Q9ZAW6 94 31 -
EGCLSVPEYYDE Q9ABF5 96 29 -
EGCLSVPGFYEE DEF_HELPY 94 31 -
EGCLSVPGFYEE DEF_HELPJ 94 31 -
EGCLSIPERQGE DEF_CLOAB 86 23 -
EGCLSFPGLSVE DEF_AQUAE 91 29 -
EGCLSVDGFRAA Q9FV53 186 43 -
EGCLSVDGFRAA Q9XI30 176 43 -
EGCLSVPDQYAE Q9REQ2 96 33 -
EGCLSIPGIYED Q9RRQ4 133 43 -
EGCLSLPGLYSE DEF_THETH 100 39 -
EGCLSIPNVYMD DEF_FREDI 105 29 -
EGCLSVDGFRAV Q9FUZ0 194 43 -
EGCLSFPNVYGD DEF_BACSU 88 25 -
EGCLSFPGIYAE Q9FUZ2 169 29 -
EGCLSFPGIYAE Q9LYJ4 169 29 -
EGCLSIPHIYER DEF_TREPA 84 24 -
EGCLSIPGLRGE DEF_CHLPN 97 35 -
EGCLSIPGLRGE DEF_CHLMU 97 35 -
EGCLSVPGAVMA DEF_STRCO 118 32 -
EGCLSVPDYYAD Q9KN16 89 26 -
EGCLSVPNVYMD DEF_SYNY3 105 29 -
EGCLSIPGLRGE DEF_CHLTR 97 35 -
EGCLSVPDFFEE Q9PIT8 94 32 -
EGCISLPKQRIE DEF_RICPR 97 34 -
EGCLSFPEIFVE DEF_THEMA 85 24 -
EGCLSFPMIHGD Q9FV54 175 29 -
EGCLSVPGWQAV Q9RD27 124 39 -
EGCLSVPGESFP DEF_MYCTU 104 36 -
EGCLSVDRVVEG Q99XY7 129 40 -
EGCLSVPTAYAP Q9K4A0 133 32 -
EGCLSVPGESFP Q9CBI2 104 36 -
EGCLSIPGVYYD DEF_BORBU 93 26 -
EGCLSVDRNVPG Q9F2F0 128 39 -
EGCLSVDRDVPG DEF2_BACST 108 31 -
EGCLSLPGLEAG Q9FCA2 140 29 -
EGCLSIPEYQAS DEF_BUCAI 89 26 -
EGCLSVDREVPG DEF_LACLA 121 44 -
EGCLSVDREVQG Q9K9I9 108 31 -
EGCLSVDDNVAG Q9F4L4 109 32 -
EGCLSVDEAIPG DEF2_BACSU 108 31 -
EGCMSVRGYSAE Q9VGY2 319 250 -
EGCLSVPKDKDG Q9KX63 120 31 -
EGCESVAGFLAC Q9HBH1 170 43 -
EGCLSVPKMHQG DEF_MYCPN 132 30 -
EGCLSVDDDRSG Q9PQ25 121 30 -
EGCLSVKKQHKG DEF_MYCGE 132 30 -

Motif 3 width=19
Element Seqn Id St Int Rpt
VPRKEKVTVRALDRDGKEF DEF_HAEIN 101 0 -
VDRPQKVRIKALDRDGNPF Q9I7A8 102 0 -
VPRAEKVKIRALDRDGKPF DEF_ECOLI 100 0 -
VPRAAEVTVKALDRNGQEY Q9KVU3 101 0 -
VTRALSIVVRFLDRHGDEQ Q9PEV2 104 0 -
VPRKEKVTIKALDRHGEEY DEF_PASMU 101 0 -
VTRAERVKVEALNEKGEKF Q9JQN0 101 0 -
VERFEKVKIEYQNRFAEVK Q9ZAW6 106 0 -
VERPSKVTLRYMNYQGETV Q9ABF5 108 0 -
VERFEKVKIEYQNRFAEVK DEF_HELPY 106 0 -
VERFEKVKIEYQNRFAEVK DEF_HELPJ 106 0 -
VERPTYVKAKALNEKGEEI DEF_CLOAB 98 0 -
VERFQKVKVNALNEHGEPV DEF_AQUAE 103 0 -
VERYLEVVVTGYDRQGKRI Q9FV53 198 0 -
VERYLEVVVTGYDRQGKRI Q9XI30 188 0 -
VRRPSVINAKWQDRDGNFH Q9REQ2 108 0 -
VPRARQVRVDYTDLDGQPR Q9RRQ4 146 1 -
VPRAERIRVEYQDEEGRGR DEF_THETH 113 1 -
VKRPEVVEIAYKDENGRPK DEF_FREDI 117 0 -
VERHLEVEVTGLDRNGKAI Q9FUZ0 206 0 -
VTRADYVKVRAFNRQGKPF DEF_BACSU 100 0 -
VVRPQSVKIDARDITGERF Q9FUZ2 181 0 -
VVRPQSVKIDARDITGERF Q9LYJ4 181 0 -
VLRPRRVSVQYLDENGKRC DEF_TREPA 96 0 -
VFRPQKITVTAMDLNGKIF DEF_CHLPN 109 0 -
VARPDKITVTAKNLDGQPF DEF_CHLMU 109 0 -
VPRPDRAVVRGLDKDGVPL DEF_STRCO 130 0 -
VERYTSVVVEALDREGKPL Q9KN16 101 0 -
VTRPRAIEVTYKDEHGRPQ DEF_SYNY3 117 0 -
VARPDKITVSAKNLDGQQF DEF_CHLTR 109 0 -
VKRYNHILLKYQDRFGEFK Q9PIT8 106 0 -
VTRPESVKIRYLDYHGKSQ DEF_RICPR 109 0 -
IERSKRIKVKYQNTRGEYV DEF_THEMA 97 0 -
VKRPESVKVDAQDINGTRF Q9FV54 187 0 -
VARHAEVRLRAHDEHGRAV Q9RD27 136 0 -
TGRAKWARVTGLDADGSPV DEF_MYCTU 116 0 -
VVRHARVTVDYYDKEGQQH Q99XY7 142 1 -
LARPDYAEVTGQDEKGNPV Q9K4A0 145 0 -
IGRAQWARVTGLDADGNPV Q9CBI2 116 0 -
LMRPKAVVINFHDENGKSF DEF_BORBU 105 0 -
VVRHARVTVDYFDKDGEKH Q9F2F0 141 1 -
VLRYARITVTGTTLDGEEV DEF2_BACST 121 1 -
TERYDEAVVTGFTVAGEPV Q9FCA2 152 0 -
IPRSNYIQVQAVNLDGEKI DEF_BUCAI 101 0 -
VVRHARVTVEYYNKEGEKK DEF_LACLA 134 1 -
VPRHARITVKAINENNEEV Q9K9I9 121 1 -
VHRHNRITIKAKDIEGNDI Q9F4L4 122 1 -
VPRYARIRVKGTTLEGENI DEF2_BACSU 121 1 -
VERFEGVKLTGLDQLGNQS Q9VGY2 331 0 -
VIRSETVKLKGFDYLTQKD Q9KX63 133 1 -
VPRFQAVQISGLDPNGEQV Q9HBH1 182 0 -
VIRHEWITITGFDWLQQKE DEF_MYCPN 145 1 -
VIRNKKVHVKAYDLISEQF Q9PQ25 134 1 -
VIRSEWITIKGYDWFEKKE DEF_MYCGE 145 1 -

Motif 4 width=30
Element Seqn Id St Int Rpt
TLDADGLLAICIQHEIDHLNGILFVDYLSP DEF_HAEIN 120 0 -
EEVAEGLLAVCIQHECDHLNGKLFVDYLST Q9I7A8 121 0 -
ELEADGLLAICIQHEMDHLVGKLFMDYLSP DEF_ECOLI 119 0 -
QFDADDLLAICVQHELDHLAGKLFVDYLSP Q9KVU3 120 0 -
QLTAEGLLAVCIQHEMDHLDGKLFIDYLSP Q9PEV2 123 0 -
TLSAEGLLAICIQHEIDHLNGIVFADYLSP DEF_PASMU 120 0 -
TLEADGLLAICVQHELDHLMGIVFVERLSQ Q9JQN0 120 0 -
VLEASELLAVAIQHEIDHLNGVLFVDKLSI Q9ZAW6 125 0 -
VEEAEGLFAVCIQHEMDHLEGVLFIDHLSR Q9ABF5 127 0 -
VLEASELLAVAIQHEIDHLNGVLFVDKLSI DEF_HELPY 125 0 -
ILEASELLAVAIQHEIDHLNGVLFVDKLSI DEF_HELPJ 125 0 -
VIEAEDLFARAICHETDHLNGVLFVDKLAE DEF_CLOAB 117 0 -
ELTLEGFPAIVFQHELDHLKGITFVDRLKG DEF_AQUAE 122 0 -
EVNASGWQARILQHECDHLDGNLYVDKMVP Q9FV53 217 0 -
EVNASGWQARILQHECDHLDGNLYVDKMVP Q9XI30 207 0 -
EERIEGLLATCLQHEMDHLEGILFIDHLSR Q9REQ2 127 0 -
SIEAEDYLARVFQHETDHLDGKLFLDHLPA Q9RRQ4 165 0 -
VLELEGYMARVFQHEIDHLDGILFFERLPK DEF_THETH 132 0 -
TLKATDLLARCIQHEMDHLNGVVFVDRVDN DEF_FREDI 136 0 -
KVDASGWQARILQHEYDHLDGTLYVDKMAP Q9FUZ0 225 0 -
ILEARGFLARAVQHEMDHLDGVLFTSKISK DEF_BACSU 119 0 -
SISLSSLPARIFQHEYDHLEGVLFFDRMTD Q9FUZ2 200 0 -
SISLSRLPARIFQHEYDHLEGVLFFDRMTD Q9LYJ4 200 0 -
AVDADGILARVIQHEYDHLDGILFLDRIDE DEF_TREPA 115 0 -
TEHLEGFTARIIMHETDHLNGVLYIDLMEE DEF_CHLPN 128 0 -
SMTLEGFLARIVMHETDHLHGVLYIDRMSD DEF_CHLMU 128 0 -
LVEGTGYFARCLAHETDHVNGHVYLDRLSG DEF_STRCO 149 0 -
RIETSDFLAIVMQHEIDHLSGNLFIDYLSP Q9KN16 120 0 -
KRLFAELTARVIQHEMDHLNGVMFVDRVDN DEF_SYNY3 136 0 -
SLALEGFLARIVMHETDHLHGVLYIDRMSD DEF_CHLTR 128 0 -
ELEAKGFLAVAIQHENDHLNGHLFIEKISF Q9PIT8 125 0 -
ELKANDWLARVIQHEYDHLEGKLMVDYLSN DEF_RICPR 128 0 -
EEELEGYAARVFQHEFDHLNGVLIIDRISP DEF_THEMA 116 0 -
EISLSALPARVFQHEFDHLQGVLFFDKMTD Q9FV54 206 0 -
DEVFAGWPARIVQHETDHLDGTLYLDRAEL Q9RD27 155 0 -
SIEGTGLFARMLQHETGHLDGFLYLDRLIG DEF_MYCTU 135 0 -
RIKLKGYNAIVVQHEIDHINGVLFYDRINA Q99XY7 161 0 -
KVRGTGYFARCLQHETDHLYGYLYIDRLSK Q9K4A0 164 0 -
TTEGTGLFARMLQHETGHLDGFLYLDYLIG Q9CBI2 135 0 -
TIENSDFLARIIQHEMDHLNGVLFIDYYEE DEF_BORBU 124 0 -
RIKLKGYNSIVVQHEIDHINGIMFYDRINE Q9F2F0 160 0 -
TLRLKGLPAIVFQHEIDHLNGIMFYDRINP DEF2_BACST 140 0 -
TVRGTGFFARCLQHECDHLEGRVYADRLTG Q9FCA2 171 0 -
EIEAKSILSICIQHEIDHLKGKLFIDYLSK DEF_BUCAI 120 0 -
KIRLKDFPAICVQHEIDHTNGVMFYDHINM DEF_LACLA 153 0 -
RLKLKGFPAIVFQHEIDHLNGIMFYDRIEG Q9K9I9 140 0 -
QLRLKGYPAIVFQHEIDHLNGVMFYDHIDK Q9F4L4 141 0 -
DIRLKGFPAIVFQHEIDHLNGVMFYDHIDK DEF2_BACSU 140 0 -
ELALSGWNARIAQHEMDHLEGKLYTDHMDR Q9VGY2 350 0 -
EISAHGLLAMCLQHEMDHLEGKFYYDSINM Q9KX63 153 1 -
VWQASGWAARIIQHEMDHLQGCLFIDKMDS Q9HBH1 201 0 -
TITATGLFGMCLQHEFDHLQGRFYYHRINP DEF_MYCPN 165 1 -
DQEFSGIIAICIQHEIGHLDAGLYYDNINQ Q9PQ25 154 1 -
TIKATGLFGMCLQHEFDHLQGRFFYQRINP DEF_MYCGE 165 1 -