SPRINT Home UMBER Home Contents Standard Search Advanced Search Relation Search

==SPRINT==> PRINTS View



  selected as


PR00613

Identifier
MYOGLOBIN  [View Relations]  [View Alignment]  
Accession
PR00613
No. of Motifs
6
Creation Date
24-SEP-1996  (UPDATE 21-JUN-1999)
Title
Myoglobin signature
Database References

PROSITE; PS01033 GLOBIN
BLOCKS; BL01033
INTERPRO; IPR002335
PDB; 1MYT
SCOP; 1MYT
CATH; 1MYT
Literature References
1. COWAN, J.A.
Inorganic Biochemistry: An Introduction.
VCH PUBLISHERS, 1993, NEW YORK.
 
2. KAIM, W. AND SCHWEDERSKI, B.
Bioinorganic Chemistry: Inorganic Elements in the Chemistry of Life.
WILEY, 1991, CHICHESTER.
 
3. KAPP, O.H., MOENS, L., VANFLETEREN, J., TROTMAN, C.N.A., SUZUKI, T.
AND VINOGRADOV, S.N.
Alignment of 700 globin sequences: Extent of amino acid substitution
and its correlation with variation in volume.
PROTEIN SCI. 4 2179-2190 (1995).
 
4. MOENS, L., VANFLETEREN, J., VAN DE PEER, Y., PEETERS, K., KAPP, O., 
CZELUZNIAK, J., GOODMAN, M., BLAXTER, M. AND VINOGRADOV, S.
Globins in nonvertebrate species: dispersal by horizontal gene transfer
and evolution of the structure-function relationships.
MOL.BIOL.EVOL. 13 324-333 (1996).

Documentation
Globins are haem-containing proteins involved in dioxygen binding and/or 
transport [1,2]. At present, more than 700 globin sequences are known [3].
It has been proposed that all globins have evolved from a family of 
ancestral, approximately 17kDa haemoproteins that displayed the globin 
fold and functioned as redox proteins [4]. The globin superfamily includes
vertebrate haemoglobins (Hb); vertebrate myoglobins (Mb); invertebrate 
globins; plant leghaemoglobins; and bacterial flavohaemoglobins. 
 
The function of vertebrate myoglobin (Mb) is storage of dioxygen in tissues.
Mb binds O(2) in the reduced [Fe(II)] state. The Mb molecule exists as a
monomer that binds iron protoporphyrin IX (haem). 
 
The 3D structures of a great number of vertebrate Mbs in various states
are known. The protein is largely alpha-helical, eight conserved helices 
(A to H) providing the scaffold for a well-defined haem-binding pocket. The
imidazole ring of the "proximal" His residue provides the fifth haem iron 
ligand; the other axial haem iron position remains essentially free for 
O(2) coordination. Conserved "distal" His and Val residues block an 
unhindered access to the sixth coordination site so that a controlled 
binding of small molecules may result only as a consequence of side-chain 
dynamics of the protein [2]. O(2) binding results in a transition from 
high-spin to low-spin iron, with accompanying changes in the Fe-N bond 
lengths and coordination geometry [1]. 
 
MYOGLOBIN is a 6-element fingerprint that provides a signature for the 
vertebrate Mbs. The fingerprint was derived from an initial alignment of 7
sequences: motif 1 largely includes helix A; motif 2 spans most of helix B
and helix C; motif 3 corresponds to helix E, and includes the conserved
distal His residue; motif 4 corresponds to helix F, and includes the
invariant proximal His residue; motif 5 spans helix G; and motif 6 spans
helix H. Motifs 3-5 are adjacent Two iterations on OWL28.2 were required to
reach convergence, at which point a true set comprising 79 sequences was
identified. Numerous partial matches were also found, all of which are
members of the globin superfamily.
 
An update on SPTR37_9f identified a true set of 75 sequences, and 1
partial match.
Summary Information
  75 codes involving  6 elements
0 codes involving 5 elements
1 codes involving 4 elements
0 codes involving 3 elements
0 codes involving 2 elements
Composite Feature Index
6757575757575
5000000
4111100
3000000
2000000
123456
True Positives
MYG_ALLMI     MYG_AOTTR     MYG_APTFO     MYG_BALAC     
MYG_BALPH MYG_BOVIN MYG_CALJA MYG_CANFA
MYG_CARCR MYG_CASFI MYG_CEBAP MYG_CEREL
MYG_CHEMY MYG_CHICK MYG_CTEGU MYG_CYPCA
MYG_DIDMA MYG_ELEMA MYG_ERIEU MYG_ESCGI
MYG_GALAU MYG_GALCR MYG_GALJA MYG_GLOME
MYG_GORBE MYG_GRAGE MYG_HALGR MYG_HETPO
MYG_HORSE MYG_HUMAN MYG_HYLAG MYG_INIGE
MYG_KOGSI MYG_LAGLA MYG_LAGMA MYG_LEPMU
MYG_LOXAF MYG_LUTLU MYG_LYCPI MYG_MACFA
MYG_MACRU MYG_MEGNO MYG_MELME MYG_MESCA
MYG_MOUSE MYG_MUSAN MYG_NYCCO MYG_OCHPR
MYG_ONDZI MYG_ORCOR MYG_ORNAN MYG_ORYAF
MYG_PANTR MYG_PAPAN MYG_PERPO MYG_PHOPH
MYG_PHOSI MYG_PHYCA MYG_PIG MYG_PONPY
MYG_PROGU MYG_RABIT MYG_ROUAE MYG_SAISC
MYG_SHEEP MYG_SPAEH MYG_TACAC MYG_THUAL
MYG_TUPGL MYG_TURTR MYG_VARVA MYG_VULCH
MYG_ZALCA MYG_ZIPCA P87497
True Positive Partials
Codes involving 4 elements
O57410
Sequence Titles
MYG_ALLMI   MYOGLOBIN - ALLIGATOR MISSISSIPPIENSIS (AMERICAN ALLIGATOR). 
MYG_AOTTR MYOGLOBIN - AOTUS TRIVIRGATUS (NIGHT MONKEY) (DOUROUCOULI).
MYG_APTFO MYOGLOBIN - APTENODYTES FORSTERI (EMPEROR PENGUIN).
MYG_BALAC MYOGLOBIN - BALAENOPTERA ACUTOROSTRATA (MINKE WHALE) (LESSER RORQUAL).
MYG_BALPH MYOGLOBIN - BALAENOPTERA PHYSALUS (FINBACK WHALE) (COMMON RORQUAL).
MYG_BOVIN MYOGLOBIN - BOS TAURUS (BOVINE).
MYG_CALJA MYOGLOBIN - CALLITHRIX JACCHUS (COMMON MARMOSET).
MYG_CANFA MYOGLOBIN - CANIS FAMILIARIS (DOG), AND OTOCYON MEGALOTIS (BAT-EARED FOX).
MYG_CARCR MYOGLOBIN - CARETTA CARETTA (LOGGERHEAD).
MYG_CASFI MYOGLOBIN - CASTOR FIBER (EURASIAN BEAVER).
MYG_CEBAP MYOGLOBIN - CEBUS APELLA (BROWN-CAPPED CAPUCHIN).
MYG_CEREL MYOGLOBIN - CERVUS ELAPHUS (RED DEER).
MYG_CHEMY MYOGLOBIN - CHELONIA MYDAS CARANIGRA (GREEN SEA-TURTLE).
MYG_CHICK MYOGLOBIN - GALLUS GALLUS (CHICKEN).
MYG_CTEGU MYOGLOBIN - CTENODACTYLUS GUNDI (NORTHERN GUNDI).
MYG_CYPCA MYOGLOBIN - CYPRINUS CARPIO (COMMON CARP).
MYG_DIDMA MYOGLOBIN - DIDELPHIS MARSUPIALIS VIRGINIANA (NORTH AMERICAN OPOSSUM).
MYG_ELEMA MYOGLOBIN - ELEPHAS MAXIMUS (INDIAN ELEPHANT).
MYG_ERIEU MYOGLOBIN - ERINACEUS EUROPAEUS (WESTERN EUROPEAN HEDGEHOG).
MYG_ESCGI MYOGLOBIN - ESCHRICHTIUS GIBBOSUS (CALIFORNIA GRAY WHALE) (ESCHRICHTIUS ROBUSTUS).
MYG_GALAU MYOGLOBIN - GALEORHINUS AUSTRALIS (SHARK).
MYG_GALCR MYOGLOBIN - GALAGO CRASSICAUDATUS (THICK-TAILED GALAGO) (OTOLEMUR CRASSICAUDATUS).
MYG_GALJA MYOGLOBIN - GALEORHINUS JAPONICUS (SHARK) (HEMITRIAKIS JAPONICA).
MYG_GLOME MYOGLOBIN - GLOBICEPHALA MELAENA (LONG-FINNED PILOT WHALE) (GLOBICEPHALA MELAS).
MYG_GORBE MYOGLOBIN - GORILLA GORILLA BERINGEI (MOUNTAIN GORILLA) (HIGHLAND GORILLA).
MYG_GRAGE MYOGLOBIN - GRAPTEMYS GEOGRAPHICA (MAP TURTLE).
MYG_HALGR MYOGLOBIN - HALICHOERUS GRYPUS (GRAY SEAL), AND PHOCA VITULINA (HARBOR SEAL).
MYG_HETPO MYOGLOBIN - HETERODONTUS PORTUSJACKSONI (PORT JACKSON SHARK).
MYG_HORSE MYOGLOBIN - EQUUS CABALLUS (HORSE), AND EQUUS BURCHELLI (PLAINS ZEBRA) (EQUUS QUAGGA).
MYG_HUMAN MYOGLOBIN - HOMO SAPIENS (HUMAN).
MYG_HYLAG MYOGLOBIN - HYLOBATES AGILIS (AGILE GIBBON), AND SYMPHALANGUS SYNDACTYLUS (SIAMANG).
MYG_INIGE MYOGLOBIN - INIA GEOFFRENSIS (AMAZON DOLPHIN).
MYG_KOGSI MYOGLOBIN - KOGIA SIMUS (DWARF SPERM WHALE).
MYG_LAGLA MYOGLOBIN - LAGOTHRIX LAGOTRICHA (COMMON WOOLLY MONKEY).
MYG_LAGMA MYOGLOBIN - LAGOSTOMUS MAXIMUS (PLAINS VISCACHA).
MYG_LEPMU MYOGLOBIN - LEPILEMUR MUSTELINUS (WEASEL LEMUR).
MYG_LOXAF MYOGLOBIN - LOXODONTA AFRICANA (AFRICAN ELEPHANT).
MYG_LUTLU MYOGLOBIN - LUTRA LUTRA (EUROPEAN RIVER OTTER).
MYG_LYCPI MYOGLOBIN - LYCAON PICTUS (AFRICAN WILD DOG) (CAPE HUNTING DOG).
MYG_MACFA MYOGLOBIN - MACACA FASCICULARIS (CRAB EATING MACAQUE) (CYNOMOLGUS MONKEY).
MYG_MACRU MYOGLOBIN - MACROPUS RUFUS (RED KANGAROO) (MEGALEIA RUFA).
MYG_MEGNO MYOGLOBIN - MEGAPTERA NOVAEANGLIAE (HUMPBACK WHALE).
MYG_MELME MYOGLOBIN - MELES MELES (EURASIAN BADGER).
MYG_MESCA MYOGLOBIN - MESOPLODON CARLHUBBSI (HUBB'S WHALE).
MYG_MOUSE MYOGLOBIN - MUS MUSCULUS (MOUSE).
MYG_MUSAN MYOGLOBIN - MUSTELUS ANTARCTICUS (GUMMY SHARK).
MYG_NYCCO MYOGLOBIN - NYCTICEBUS COUCANG (SLOW LORIS).
MYG_OCHPR MYOGLOBIN - OCHOTONA PRINCEPS (SOUTHERN AMERICAN PIKA).
MYG_ONDZI MYOGLOBIN - ONDATRA ZIBETHICUS (MUSKRAT).
MYG_ORCOR MYOGLOBIN - ORCINUS ORCA (KILLER WHALE).
MYG_ORNAN MYOGLOBIN - ORNITHORHYNCHUS ANATINUS (DUCKBILL PLATYPUS).
MYG_ORYAF MYOGLOBIN - ORYCTEROPUS AFER (AARDVARK).
MYG_PANTR MYOGLOBIN - PAN TROGLODYTES (CHIMPANZEE).
MYG_PAPAN MYOGLOBIN - PAPIO ANUBIS (OLIVE BABOON), ERYTHROCEBUS PATAS (RED GUENON) (HUSSAR), AND PRESBYTIS ENTELLUS (HANUMAN LANGUR).
MYG_PERPO MYOGLOBIN - PERODICTICUS POTTO EDWARSI (POTTO).
MYG_PHOPH MYOGLOBIN - PHOCOENOIDES PHOCOENA (HARBOR PORPOISE), AND PHOCOENOIDES DALLI DALLI (DALL'S PORPOISE).
MYG_PHOSI MYOGLOBIN - PHOCA SIBIRICA (BAIKAL SEAL).
MYG_PHYCA MYOGLOBIN - PHYSETER CATODON (SPERM WHALE) (PHYSETER MACROCEPHALUS).
MYG_PIG MYOGLOBIN - SUS SCROFA (PIG).
MYG_PONPY MYOGLOBIN - PONGO PYGMAEUS (ORANGUTAN).
MYG_PROGU MYOGLOBIN - PROECHIMYS GUAIRAE (CASIRAGUA).
MYG_RABIT MYOGLOBIN - ORYCTOLAGUS CUNICULUS (RABBIT).
MYG_ROUAE MYOGLOBIN - ROUSETTUS AEGYPTIACUS (EGYPTIAN ROUSETTE) (EGYPTIAN FRUIT BAT).
MYG_SAISC MYOGLOBIN - SAIMIRI SCIUREUS (COMMON SQUIRREL MONKEY).
MYG_SHEEP MYOGLOBIN - OVIS ARIES (SHEEP).
MYG_SPAEH MYOGLOBIN - SPALAX LEUCODON EHRENBERGI (EHRENBERG'S MOLE RAT).
MYG_TACAC MYOGLOBIN - TACHYGLOSSUS ACULEATUS ACULEATUS (AUSTRALIAN ECHIDNA).
MYG_THUAL MYOGLOBIN - THUNNUS ALBACARES (YELLOWFIN TUNA) (NEOTHUNNUS MACROPTERUS).
MYG_TUPGL MYOGLOBIN - TUPAIA GLIS (TREE SHREW).
MYG_TURTR MYOGLOBIN - TURSIOPS TRUNCATUS (ATLANTIC BOTTLE-NOSED DOLPHIN), AND DELPHINUS DELPHIS (SADDLEBACK DOLPHIN) (BLACK SEA DOLPHIN).
MYG_VARVA MYOGLOBIN - VARANUS VARIUS (LACE MONITOR).
MYG_VULCH MYOGLOBIN - VULPES CHAMA (CAPE FOX).
MYG_ZALCA MYOGLOBIN - ZALOPHUS CALIFORNIANUS (CALIFORNIA SEALION).
MYG_ZIPCA MYOGLOBIN - ZIPHIUS CAVIROSTRIS (GOOSE-BEAKED WHALE).
P87497 MYOGLOBIN - CHIONODRACO RASTROSPINOSUS.

O57410 MUTANT MYOGLOBIN - CHAMPSOCEPHALUS GUNNARI.
Scan History
OWL28_2    2  170  NSINGLE    
SPTR37_9f 1 90 NSINGLE
Initial Motifs
Motif 1  width=15
Element Seqn Id St Int Rpt
EWQLVLHVWAKVEAD MYG_PHYCA 6 6 -
EWQQVLTIWGKVEAD MYG_CHICK 6 6 -
DFDAVLKCWGPVEAD MYG_THUAL 2 2 -
EWEHVNKVWAVVEPD MYG_HETPO 2 2 -
DAELVLKCWGGVEAD MYG_CYPCA 2 2 -
DWEKVNSVWSAVESD MYG_MUSAN 2 2 -
DWDKVNSVWSAMEAN MYG_GALAU 2 2 -

Motif 2 width=24
Element Seqn Id St Int Rpt
GQDILIRLFKSHPETLEKFDRFKH MYG_PHYCA 25 4 -
GHEVLMRLFHDHPETLDRFDKFKG MYG_CHICK 25 4 -
GGLVLTRLFKEHPETQKLFPKFAG MYG_THUAL 21 4 -
GLAILLRLFKEHKETKDLFPKFKE MYG_HETPO 21 4 -
GGEVLTRLFKQHPETQKLFPKFVG MYG_CYPCA 21 4 -
GQNILLRLFEQYPESQNHFPKFKN MYG_MUSAN 21 4 -
GQNILLRLFEQYPESQSYFPKLKN MYG_GALAU 21 4 -

Motif 3 width=21
Element Seqn Id St Int Rpt
SEDLKKHGVTVLTALGAILKK MYG_PHYCA 58 9 -
SEDLKKHGATVLTQLGKILKQ MYG_CHICK 58 9 -
NAAISAHGATVLKKLGELLKA MYG_THUAL 53 8 -
NEDLRKHGVTVLRALGNILKQ MYG_HETPO 53 8 -
NAAVKAHGATVLKKLGELLKA MYG_CYPCA 53 8 -
TADIKAQADTVLSALGNIVKK MYG_MUSAN 53 8 -
TADIKAQADTVLKALGNIVKK MYG_GALAU 53 8 -

Motif 4 width=18
Element Seqn Id St Int Rpt
KGHHEAELKPLAQSHATK MYG_PHYCA 79 0 -
KGNHESELKPLAQTHATK MYG_CHICK 79 0 -
KGSHAAILKPLANSHATK MYG_THUAL 74 0 -
KGKHSTNVKELADTHINK MYG_HETPO 74 0 -
RGDHAAILKPLATTHANT MYG_CYPCA 74 0 -
KGSHSQPVKALAATHITT MYG_MUSAN 74 0 -
KGNHSQPVKALAATHITT MYG_GALAU 74 0 -

Motif 5 width=21
Element Seqn Id St Int Rpt
HKIPIKYLEFISEAIIHVLHS MYG_PHYCA 97 0 -
HKIPVKYLEFISEVIIKVIAE MYG_CHICK 97 0 -
HKIPINNFKLISEVLVKVMHE MYG_THUAL 92 0 -
HKIPPKNFVLITNIAVKVLTE MYG_HETPO 92 0 -
HKIALNNFRLITEVLVKVMAE MYG_CYPCA 92 0 -
HKIPPHYFTKITTIAVDVLSE MYG_MUSAN 92 0 -
HKIPPHYFTKITTIAVGVLSE MYG_GALAU 92 0 -

Motif 6 width=30
Element Seqn Id St Int Rpt
FGADAQGAMNKALELFRKDIAAKYKELGYQ MYG_PHYCA 123 5 -
FGADSQAAMKKALELFRNDMASKYKEFGFQ MYG_CHICK 123 5 -
LDAGGQTALRNVMGIIIADLEANYKELGFS MYG_THUAL 116 3 -
MTGPMQESFSKVFTVICSDLETLYKEANFQ MYG_HETPO 118 5 -
LDAGGQSALRRVMDVVIGDIDTYYKEIGFA MYG_CYPCA 116 3 -
MNAQVQAAFSGAFKIICSDIEKEYKAANFQ MYG_MUSAN 118 5 -
MNAQAQEAFSGAFKSICSDIEKEYKAANFQ MYG_GALAU 118 5 -
Final Motifs
Motif 1  width=15
Element Seqn Id St Int Rpt
EWQLVLNVWGKVEAD MYG_PIG 6 6 -
EWQLVLNVWGKVEAD MYG_LUTLU 6 6 -
EWQLVLNVWGKVEAD MYG_TUPGL 6 6 -
EWQLVLNIWGKVEAD MYG_INIGE 6 6 -
EWQLVLNVWGKVEAD MYG_LEPMU 6 6 -
EWQLVLNVWGKVEAD MYG_MACFA 6 6 -
EWQLVLNVWGKVEAD MYG_PAPAN 6 6 -
EWQLVLNVWGKVEAD MYG_GLOME 6 6 -
EWQLVLNVWGKVEAD MYG_ROUAE 6 6 -
EWQLVLNVWGKVEAD MYG_GORBE 6 6 -
EWQLVLNVWGKVEAD MYG_HUMAN 6 6 -
EWQLVLNVWGKVEAD MYG_HYLAG 6 6 -
EWQLVLNVWGKVEAD MYG_PONPY 6 6 -
EWQLVLNVWGKVEAD MYG_PHOPH 6 6 -
EWQLVLNVWGKVEAD MYG_TURTR 6 6 -
EWQLVLNVWGKVEAD MYG_PANTR 6 6 -
EWQLVLNVWGKVEAD MYG_RABIT 6 6 -
EWQQVLNVWGKVEAD MYG_HORSE 6 6 -
EWQLVLNVWGKVEAD MYG_AOTTR 6 6 -
EWQLVLNVWGKVEAD MYG_CALJA 6 6 -
EWQLVLNIWAKVEAD MYG_ESCGI 6 6 -
EWQLVLNIWAKVEAD MYG_MEGNO 6 6 -
EWQLVLNVWGKVEAD MYG_ORCOR 6 6 -
EWQLVLNVWGKVEAD MYG_OCHPR 6 6 -
EWQSVLNVWGKVEAD MYG_PERPO 6 6 -
EWQLVLNVWGKVEAD MYG_MELME 6 6 -
EWQLVLNVWGKVEAD MYG_LAGMA 6 6 -
EWQLVLNVWGKVEAD MYG_CEBAP 6 6 -
EWQLVLNIWGKVEAD MYG_ZALCA 6 6 -
EWQLVLHVWAKVEAD MYG_MESCA 6 6 -
EWQLVLNVWGKVEAD MYG_ORYAF 6 6 -
EWQLVLHVWGKVEAD MYG_CASFI 6 6 -
EWQLVLHVWAKVEAD MYG_ZIPCA 6 6 -
EWHLVLNVWGKVETD MYG_HALGR 6 6 -
EWQLVLNVWGKVEGD MYG_PROGU 6 6 -
EWHLVLNIWAKVEAD MYG_BALAC 6 6 -
EWQLVLNAWGKVETD MYG_CTEGU 6 6 -
EWQLVLNVWGKVEAD MYG_ERIEU 6 6 -
EWQSVLNVWGKVEAD MYG_NYCCO 6 6 -
EWQLVLNIWGKVEAD MYG_LAGLA 6 6 -
EWQLVLHVWGKVEAD MYG_ONDZI 6 6 -
EWQLVLNIWGKVETD MYG_VULCH 6 6 -
EWHLVLNIWAKVEAD MYG_BALPH 6 6 -
EWQLVLNVWGKVEGD MYG_SPAEH 6 6 -
EWQLVLNIWGKVEAD MYG_SAISC 6 6 -
EWQLVLHVWAKVEAD MYG_PHYCA 6 6 -
EWQLVLHVWAKVEAD MYG_KOGSI 6 6 -
EWQIVLNIWGKVETD MYG_CANFA 6 6 -
EWQLVLKIWGKVEAD MYG_GALCR 6 6 -
EWQIVLNIWGKVETD MYG_LYCPI 6 6 -
EWQLVLNAWGKVEAD MYG_DIDMA 6 6 -
EWHLVLNVWGKWETD MYG_PHOSI 6 6 -
EWQLVLNAWGKVEAD MYG_SHEEP 6 6 -
EWQLVLNAWGKVEAD MYG_CEREL 6 6 -
EWQLVLNAWGKVEAD MYG_BOVIN 6 6 -
EWQLVLNIWGKVETD MYG_MACRU 6 6 -
EWELVLKTWGKVEAD MYG_LOXAF 6 6 -
EWQLVLNVWGKVEAD MYG_MOUSE 6 6 -
EWQLVLKVWGKVEGD MYG_ORNAN 6 6 -
EWQLVLKVWGKVETD MYG_TACAC 6 6 -
EWELVLKTWGKVEAD MYG_ELEMA 6 6 -
EWQQVLTIWGKVEAD MYG_CHICK 6 6 -
EWNHVLGIWAKVEPD MYG_CARCR 6 6 -
EWHHVLGIWAKVEPD MYG_GRAGE 6 6 -
EWNHVLGIWAKVEPD MYG_CHEMY 6 6 -
EWQQVLTMWGKVESD MYG_APTFO 6 6 -
EWKKVVDIWGKVEPD MYG_VARVA 6 6 -
EWKHVLDIWTKVESK MYG_ALLMI 7 7 -
DFDAVLKCWGPVEAD MYG_THUAL 2 2 -
EWEHVNKVWAVVEPD MYG_HETPO 2 2 -
DAELVLKCWGGVEAD MYG_CYPCA 2 2 -
DWEKVNSVWSAVESD MYG_MUSAN 2 2 -
BWDKVNSVWSAVEQN MYG_GALJA 2 2 -
DWDKVNSVWSAMEAN MYG_GALAU 2 2 -
DFDMVLKCWGPMEAD P87497 3 3 -

Motif 2 width=24
Element Seqn Id St Int Rpt
GQEVLIRLFKGHPETLEKFDKFKH MYG_PIG 25 4 -
GQEVLIRLFKGHPETLEKFDKFKH MYG_LUTLU 25 4 -
GQEVLIRLFKGHPETLEKFDKFKH MYG_TUPGL 25 4 -
GQDVLIRLFKGHPETLEKFDKFKH MYG_INIGE 25 4 -
GQEVLIRLFTGHPETLEKFDKFKH MYG_LEPMU 25 4 -
GQEVLIRLFKGHPETLEKFDKFKH MYG_MACFA 25 4 -
GQEVLIRLFKGHPETLEKFDKFKH MYG_PAPAN 25 4 -
GQDILIRLFKGHPETLEKFDKFKH MYG_GLOME 25 4 -
GQEVLIRLFKGHPETLEKFDKFKH MYG_ROUAE 25 4 -
GQEVLIRLFKGHPETLEKFDKFKH MYG_GORBE 25 4 -
GQEVLIRLFKGHPETLEKFDKFKH MYG_HUMAN 25 4 -
GQEVLIRLFKGHPETLEKFDKFKH MYG_HYLAG 25 4 -
GQEVLIRLFKGHPETLEKFDKFKH MYG_PONPY 25 4 -
GQDVLIRLFKGHPETLEKFDKFKH MYG_PHOPH 25 4 -
GQDVLIRLFKGHPETLEKFDKFKH MYG_TURTR 25 4 -
GQEVLIRLFKGHPETLEKFDKFKH MYG_PANTR 25 4 -
GQEVLIRLFHTHPETLEKFDKFKH MYG_RABIT 25 4 -
GQEVLIRLFTGHPETLEKFDKFKH MYG_HORSE 25 4 -
GQEVLISLFKGHPETLEKFDKFKH MYG_AOTTR 25 4 -
GQEVLISLFKGHPETLEKFDKFKH MYG_CALJA 25 4 -
GQDILIRLFKGHPETLEKFDKFKH MYG_ESCGI 25 4 -
GQDILIRLFKGHPETLEKFDKFKH MYG_MEGNO 25 4 -
GQDILIRLFKGHPETLEKFDKFKH MYG_ORCOR 25 4 -
GQEVLIRLFKNHPETLEKFDKFKN MYG_OCHPR 25 4 -
GQEILIRLFTAHPETLEKFDKFKN MYG_PERPO 25 4 -
GQEVLIRLFKGHPETLEKFDKFKH MYG_MELME 25 4 -
GQEVLIRLFKGHPETLEKFDKFKH MYG_LAGMA 25 4 -
GQEVLISLFKGHPETLEKFDKFKH MYG_CEBAP 25 4 -
GQEVLIRLFKGHPETLEKFDKFKH MYG_ZALCA 25 4 -
GQEILIRLFKGHPETLEKFDKFKH MYG_MESCA 25 4 -
GQDVLIRLFKGHPETLEKFDRFKH MYG_ORYAF 25 4 -
GQEVLIRLFKGHPETLEKFNKFKH MYG_CASFI 25 4 -
GQEILIRLFKGHPETLEKFDKFKH MYG_ZIPCA 25 4 -
GQEVLIRLFKSHPETLEKFDKFKH MYG_HALGR 25 4 -
GQEVLIRLFKGHPETLEKFDKFKH MYG_PROGU 25 4 -
GQDILIRLFKGHPETLEKFDKFKH MYG_BALAC 25 4 -
GQEVLIRLFKGHPETLEKFDKFKH MYG_CTEGU 25 4 -
GQEVLIRLFKDHPETLEKFDKFKH MYG_ERIEU 25 4 -
GQEILIRLFTAHPETLEKFDKFKN MYG_NYCCO 25 4 -
GQEVLISLFKGHPETLEKFDKFKH MYG_LAGLA 25 4 -
GQDVLIRLFKAHPETLEKFDKFKH MYG_ONDZI 25 4 -
GQEVLIRLFKNHPETLDKFDKFKH MYG_VULCH 25 4 -
GQDILISLFKGHPETLEKFDKFKH MYG_BALPH 25 4 -
GQEVLIKLFKNHPETLEKFDKFKH MYG_SPAEH 25 4 -
GQEVLISLFKGHPETLEKFDKFKH MYG_SAISC 25 4 -
GQDILIRLFKSHPETLEKFDRFKH MYG_PHYCA 25 4 -
GQDILIRLFKHHPETLEKFDRFKH MYG_KOGSI 25 4 -
GQEVLIRLFKNHPETLDKFDKFKH MYG_CANFA 25 4 -
GQDVLIRLFTAHPETLEKFDKFKN MYG_GALCR 25 4 -
GQEVLIRLFKNHPETLDKFDKFKH MYG_LYCPI 25 4 -
GQEVLIRLFKGHPETLEKFDKFKH MYG_DIDMA 25 4 -
GQEVLIRLFKSHPETLEKFDKFKH MYG_PHOSI 25 4 -
GQEVLIRLFTGHPETLEKFDKFKH MYG_SHEEP 25 4 -
GQEVLIRLFTGHPETLEKFDKFKH MYG_CEREL 25 4 -
GQEVLIRLFTGHPETLEKFDKFKH MYG_BOVIN 25 4 -
GKDVLIRLFKGHPETLEKFDKFKH MYG_MACRU 25 4 -
GEFVLVRLFTGHPETLEKFDKFKH MYG_LOXAF 25 4 -
GQEVLIGLFKTHPETLDKFDKFKN MYG_MOUSE 25 4 -
GQEVLIRLFKTHPETLEKFDKFKG MYG_ORNAN 25 4 -
GQDVLIRLFKTHPETLEKFDKFKH MYG_TACAC 25 4 -
GETVFVRLFTGHPETLEKFDKFKH MYG_ELEMA 25 4 -
GHEVLMRLFHDHPETLDRFDKFKG MYG_CHICK 25 4 -
GQEVIIRLFQLHPETQERFAKFKN MYG_CARCR 25 4 -
GQEVIIRLFQVHPETQERFAKFKN MYG_GRAGE 25 4 -
GQEVIIRLFQLHPETQERFAKFKN MYG_CHEMY 25 4 -
GHAVLMRLFKSHPETMDRFDKFRG MYG_APTFO 25 4 -
GQEVIIRMFQNHPETQDRFAKFKN MYG_VARVA 25 4 -
GHEVIIRLLQEHPETQERFEKFKH MYG_ALLMI 26 4 -
GGLVLTRLFKEHPETQKLFPKFAG MYG_THUAL 21 4 -
GLAILLRLFKEHKETKDLFPKFKE MYG_HETPO 21 4 -
GGEVLTRLFKQHPETQKLFPKFVG MYG_CYPCA 21 4 -
GQNILLRLFEQYPESQNHFPKFKN MYG_MUSAN 21 4 -
GQNILLRLFEQYPESEDYFPKLKN MYG_GALJA 21 4 -
GQNILLRLFEQYPESQSYFPKLKN MYG_GALAU 21 4 -
GSLVLTRLFTEHPETLKLFPKFAG P87497 22 4 -

Motif 3 width=21
Element Seqn Id St Int Rpt
SEDLKKHGNTVLTALGGILKK MYG_PIG 58 9 -
SEDLKKHGNTVLTALGGILKK MYG_LUTLU 58 9 -
SEDLKKHGNTVLSALGGILKK MYG_TUPGL 58 9 -
SEDLKKHGNTVLTALGGILKK MYG_INIGE 58 9 -
SEDLKKHGTTVLTALGGILKK MYG_LEPMU 58 9 -
SEDLKKHGVTVLTALGGILKK MYG_MACFA 58 9 -
SEDLKKHGATVLTALGGILKK MYG_PAPAN 58 9 -
SEDLKKHGNTVLTALGAILKK MYG_GLOME 58 9 -
SEDLKKHGATVLTALGGILKK MYG_ROUAE 58 9 -
SEDLKKHGATVLTALGGILKK MYG_GORBE 58 9 -
SEDLKKHGATVLTALGGILKK MYG_HUMAN 58 9 -
SEDLKKHGATVLTALGGILKK MYG_HYLAG 58 9 -
SEDLKKHGATVLTALGGILKK MYG_PONPY 58 9 -
SEDLKKHGNTVLTALGGILKK MYG_PHOPH 58 9 -
SEDLKKHGNTVLTALGAILKK MYG_TURTR 58 9 -
SEDLKKHGATVLTALGGILKK MYG_PANTR 58 9 -
SEDLKKHGNTVLTALGAILKK MYG_RABIT 58 9 -
SEDLKKHGTVVLTALGGILKK MYG_HORSE 58 9 -
SEELKKHGVTVLTALGGILKK MYG_AOTTR 58 9 -
SEELKKHGVTVLTALGGILKK MYG_CALJA 58 9 -
SEDLKKHGNTVLTALGGILKK MYG_ESCGI 58 9 -
SEDLKKHGNTVLTALGGILKK MYG_MEGNO 58 9 -
SEDLKKHGNTVLTALGAILKK MYG_ORCOR 58 9 -
SDDLKKHGNTVLSALGGILKK MYG_OCHPR 58 9 -
SEDLKKHGVTVLTALGGILKK MYG_PERPO 58 9 -
SEDLKKHGNTVLTALGGILKK MYG_MELME 58 9 -
SEDLKKHGTTVLTALGGILKK MYG_LAGMA 58 9 -
SEELKKHGATVLTALGGILKK MYG_CEBAP 58 9 -
SEDLKKHGKTVLTALGGILKK MYG_ZALCA 58 9 -
SEDLKKHGHTVLTALGGILKK MYG_MESCA 58 9 -
SEDLKKHGTTVLTALGGILKK MYG_ORYAF 58 9 -
SEDLKKHGVTVLTALGGVLKK MYG_CASFI 58 9 -
SEDLKKHGHTVLTALGGILKK MYG_ZIPCA 58 9 -
SEDLRKHGNTVLTALGGILKK MYG_HALGR 58 9 -
SEELKKHGTTVLTALGGILKK MYG_PROGU 58 9 -
SEDLKKHGNTVLTALGGILKK MYG_BALAC 58 9 -
SEDLKKHGTTVLTALGNILKK MYG_CTEGU 58 9 -
SEDLKKHGTTVLTALGGILKK MYG_ERIEU 58 9 -
SEDLKKHGVTVLTALGGILKK MYG_NYCCO 58 9 -
SEELKKHGVTVLTALGGILKK MYG_LAGLA 58 9 -
SEDLKKHGBTVLTALGGILKK MYG_ONDZI 58 9 -
SEDLKKHGNTVLTALGGILKK MYG_VULCH 58 9 -
SEDLKKHGNTVLTALGGILKK MYG_BALPH 58 9 -
SEDLKKHGNTVLTALGGILKK MYG_SPAEH 58 9 -
SEELKKHGTTVLTALGGILKK MYG_SAISC 58 9 -
SEDLKKHGVTVLTALGAILKK MYG_PHYCA 58 9 -
SEDLKKHGVTVLTALGAILKK MYG_KOGSI 58 9 -
SEDLKKHGNTVLTALGGILKK MYG_CANFA 58 9 -
SEDLKKHGVTVLTALGGILKK MYG_GALCR 58 9 -
SEDLKKHGNTVLTALGGILKK MYG_LYCPI 58 9 -
SEDLKKHGATVLTALGNILKK MYG_DIDMA 58 9 -
SFDLRKHGNTVLTALGGILKK MYG_PHOSI 58 9 -
SEDLKKHGNTVLTALGGILKK MYG_SHEEP 58 9 -
SEDLKKHGNTVLTALGGILKK MYG_CEREL 58 9 -
SEDLKKHGNTVLTALGGILKK MYG_BOVIN 58 9 -
SEDLKKHGITVLTALGNILKK MYG_MACRU 58 9 -
SEDLKKQGVTVLTALGGILKK MYG_LOXAF 58 9 -
SEDLKKHGCTVLTALGTILKK MYG_MOUSE 58 9 -
SADLKKHGGTVLTALGNILKK MYG_ORNAN 58 9 -
SADLKKHGGVVLTALGSILKK MYG_TACAC 58 9 -
SEDLKKQGVTVLTALGGILKK MYG_ELEMA 58 9 -
SEDLKKHGATVLTQLGKILKQ MYG_CHICK 58 9 -
SEEVKKHGTTVLTALGRILKQ MYG_CARCR 58 9 -
SEEVKKHGTTVLTALGRILKL MYG_GRAGE 58 9 -
SEEVKKHGTTVLTALGRILKQ MYG_CHEMY 58 9 -
SEDMKKHGVTVLTLGQILKKK MYG_APTFO 58 9 -
SEDLKKHGTTVLTALGRILKQ MYG_VARVA 58 9 -
SEKMKQHGNTVFTALGNILKQ MYG_ALLMI 59 9 -
NAAISAHGATVLKKLGELLKA MYG_THUAL 53 8 -
NEDLRKHGVTVLRALGNILKQ MYG_HETPO 53 8 -
NAAVKAHGATVLKKLGELLKA MYG_CYPCA 53 8 -
TADIKAQADTVLSALGNIVKK MYG_MUSAN 53 8 -
TADIKAQADTVLRALGNIVKK MYG_GALJA 53 8 -
TADIKAQADTVLKALGNIVKK MYG_GALAU 53 8 -
DAGVSAHGATVLNKLGDLLKA P87497 54 8 -

Motif 4 width=18
Element Seqn Id St Int Rpt
KGHHEAELTPLAQSHATK MYG_PIG 79 0 -
KGKHEAELKPLAQSHATK MYG_LUTLU 79 0 -
KGQHEAEIKPLAQSHATK MYG_TUPGL 79 0 -
KGHHEAELKPLAQSHATK MYG_INIGE 79 0 -
KGQHEAELKPLAQSHATK MYG_LEPMU 79 0 -
KGHHEAEIKPLAQSHATK MYG_MACFA 79 0 -
KGHHEAEIKPLAQSHATK MYG_PAPAN 79 0 -
KGHHEAELKPLAQSHATK MYG_GLOME 79 0 -
KGQHEAQLKPLAQSHATK MYG_ROUAE 79 0 -
KGHHEAEIKPLAQSHATK MYG_GORBE 79 0 -
KGHHEAEIKPLAQSHATK MYG_HUMAN 79 0 -
KGHHEAEIKPLAQSHATK MYG_HYLAG 79 0 -
KGHHEAEIKPLAQSHATK MYG_PONPY 79 0 -
KGHHDAELKPLAQSHATK MYG_PHOPH 79 0 -
KGHHDAELKPLAQSHATK MYG_TURTR 79 0 -
KGHHEAEIKPLAQSHATK MYG_PANTR 79 0 -
KGHHEAEIKPLAQSHATK MYG_RABIT 79 0 -
KGHHEAELKPLAQSHATK MYG_HORSE 79 0 -
KGHHEAELKPLAQSHATK MYG_AOTTR 79 0 -
KGHHEAELKPLAQSHATK MYG_CALJA 79 0 -
KGHHEAELKPLAQSHATK MYG_ESCGI 79 0 -
KGHHEAELKPLAQSHATK MYG_MEGNO 79 0 -
KGHHDAELKPLAQSHATK MYG_ORCOR 79 0 -
KGQHEAELKPLAQSHATK MYG_OCHPR 79 0 -
KGHHEAEIKPLAQSHATK MYG_PERPO 79 0 -
KGHQEAELKPLAQSHATK MYG_MELME 79 0 -
RGQHAAELAPLAQSHATK MYG_LAGMA 79 0 -
KGQHEAELKPLAQSHATK MYG_CEBAP 79 0 -
KGHHDAELKPLAQSHATK MYG_ZALCA 79 0 -
KGHHEAELKPLAQSHATK MYG_MESCA 79 0 -
KGQHEAEIQPLAQSHATK MYG_ORYAF 79 0 -
KGHHEAEIKPLAQSHATK MYG_CASFI 79 0 -
KGHHEAELKPLAQSHATK MYG_ZIPCA 79 0 -
KGHHEAELKPLAQSHATK MYG_HALGR 79 0 -
KGQHAAELAPLAQSHATK MYG_PROGU 79 0 -
KGHHEAELKPLAQSHATK MYG_BALAC 79 0 -
KGQHEAELAPLAQSHATK MYG_CTEGU 79 0 -
KGQHEAQLAPLAQSHANK MYG_ERIEU 79 0 -
KGQHEAEIKPLAQSHATK MYG_NYCCO 79 0 -
KGQHEAELKPLAQSHATK MYG_LAGLA 79 0 -
KGHHEAEIKPLAQSHATK MYG_ONDZI 79 0 -
KGHHEAELKPLAQSHATK MYG_VULCH 79 0 -
KGHHEAELKPLAQSHATK MYG_BALPH 79 0 -
KGQHAAEIQPLAQSHATK MYG_SPAEH 79 0 -
KGQHEAELKPLAQSHATK MYG_SAISC 79 0 -
KGHHEAELKPLAQSHATK MYG_PHYCA 79 0 -
KGHHEAELKPLAQSHATK MYG_KOGSI 79 0 -
KGHHEAELKPLAQSHATK MYG_CANFA 79 0 -
KGQHEAEIKPLAQSHATK MYG_GALCR 79 0 -
KGHHEAELKPLAQSHATK MYG_LYCPI 79 0 -
KGNHEAELKPLAQSHATK MYG_DIDMA 79 0 -
KGHHEAELKPLAQSHATK MYG_PHOSI 79 0 -
KGHHEAEVKHLAESHANK MYG_SHEEP 79 0 -
KGHHEAEVKHLAESHANK MYG_CEREL 79 0 -
KGHHEAEVKHLAESHANK MYG_BOVIN 79 0 -
KGHHEAELKPLAQSHATK MYG_MACRU 79 0 -
KGHHEAEIQPLAQSHATK MYG_LOXAF 79 0 -
KGQHAAEIQPLAQSHATK MYG_MOUSE 79 0 -
KGQHEAELKPLAQSHATK MYG_ORNAN 79 0 -
KGQHEAELKPLAQSHATK MYG_TACAC 79 0 -
KGHHEAEIQPLAQSHATK MYG_ELEMA 79 0 -
KGNHESELKPLAQTHATK MYG_CHICK 79 0 -
KNNHEQELKPLAESHATK MYG_CARCR 79 0 -
KNNHEPELKPLAESHATK MYG_GRAGE 79 0 -
KNNHEQELKPLAESHATK MYG_CHEMY 79 0 -
KGHHEAELKPLSQTHATK MYG_APTFO 78 -1 -
KGHHEAEIAPLAQTHANT MYG_VARVA 79 0 -
KGNHAEVLKPLAKSHALE MYG_ALLMI 80 0 -
KGSHAAILKPLANSHATK MYG_THUAL 74 0 -
KGKHSTNVKELADTHINK MYG_HETPO 74 0 -
RGDHAAILKPLATTHANT MYG_CYPCA 74 0 -
KGSHSQPVKALAATHITT MYG_MUSAN 74 0 -
KGDHSQPVKALAATHITT MYG_GALJA 74 0 -
KGNHSQPVKALAATHITT MYG_GALAU 74 0 -
RGAHAALLKPLSSSHATK P87497 75 0 -

Motif 5 width=21
Element Seqn Id St Int Rpt
HKIPVKYLEFISEAIIQVLQS MYG_PIG 97 0 -
HKIPIKYLEFISEAIIQVLQS MYG_LUTLU 97 0 -
HKIPVKYLEFISEAIIQVLQS MYG_TUPGL 97 0 -
HKIPIKYLEFISEAIIHVLHS MYG_INIGE 97 0 -
HKIPIKYLEFISDAIVHVLHS MYG_LEPMU 97 0 -
HKIPVKYLELISESIIQVLQS MYG_MACFA 97 0 -
HKIPVKYLELISESIIQVLQS MYG_PAPAN 97 0 -
HKIPIKYLEFISEAIIHVLHS MYG_GLOME 97 0 -
HKIPVKYLEFISEVIIQVLQS MYG_ROUAE 97 0 -
HKIPVKYLEFISECIIQVLQS MYG_GORBE 97 0 -
HKIPVKYLEFISECIIQVLQS MYG_HUMAN 97 0 -
HKIPVKYLEFISECIIQVLQS MYG_HYLAG 97 0 -
HKIPVKYLEFISESIIQVLQS MYG_PONPY 97 0 -
HKIPIKYLEFISEAIIHVLHS MYG_PHOPH 97 0 -
HKIPIKYLEFISEAIIHVLHS MYG_TURTR 97 0 -
HKIPVKYLEFISECIIQVLHS MYG_PANTR 97 0 -
HKIPVKYLEFISEAIIHVLHS MYG_RABIT 97 0 -
HKIPIKYLEFISDAIIHVLHS MYG_HORSE 97 0 -
HKIPVKYLEFISDAIVHVLQK MYG_AOTTR 97 0 -
HKIPVKYLEFISDAIVHVLQK MYG_CALJA 97 0 -
HKIPIKYLEFISDAIIHVLHS MYG_ESCGI 97 0 -
HKIPIKYLEFISDAIIHVLHS MYG_MEGNO 97 0 -
HKIPIKYLEFISEAIIHVLHS MYG_ORCOR 97 0 -
HKIPVKYLEFISEAIIQVLQS MYG_OCHPR 97 0 -
HKIPVKYLEFISEAIIHVLQS MYG_PERPO 97 0 -
HKIPVKYLEFISDAIAQVLQS MYG_MELME 97 0 -
HKIPVKYLEFISEAIIQVLQS MYG_LAGMA 97 0 -
HKIPVKYLEFISDAIVHVLQK MYG_CEBAP 97 0 -
HKIPIKYLEFISEAIIHVLQS MYG_ZALCA 97 0 -
HKIPIKYLEFISDAIIHVLHS MYG_MESCA 97 0 -
HKIPVKYLEFISEAIIQVIQS MYG_ORYAF 97 0 -
HKIPIKYLEFISEAIIHVLQS MYG_CASFI 97 0 -
HKIPIKYLEFISDAIIHVLHS MYG_ZIPCA 97 0 -
HKIPIKYLEFISEAIIHVLHS MYG_HALGR 97 0 -
HKIPVKYLEFISEAIIQVLQS MYG_PROGU 97 0 -
HKIPIKYLEFISDAIIHVLHS MYG_BALAC 97 0 -
HKIPVKYLEFISEAIIQVLES MYG_CTEGU 97 0 -
HKIPVKYLEFISEAIIQVLKS MYG_ERIEU 97 0 -
HKIPVKYLEFISGAIIHVLQS MYG_NYCCO 97 0 -
HKIPVKYLEFISDAIIHALQK MYG_LAGLA 97 0 -
HKIPIKYLEFISEAIIHVLZS MYG_ONDZI 97 0 -
HKIPVKYLEFISDAIIQVLQS MYG_VULCH 97 0 -
HKIPIKYLEFISDAIIHVLHS MYG_BALPH 97 0 -
HKIPIKYLEFISEAIIQVLQS MYG_SPAEH 97 0 -
HKIPVKYLELISDAIVHVLQK MYG_SAISC 97 0 -
HKIPIKYLEFISEAIIHVLHS MYG_PHYCA 97 0 -
HKIPIKYLEFISEAIIHVLHS MYG_KOGSI 97 0 -
HKIPVKYLEFISDAIIQVLQS MYG_CANFA 97 0 -
HKIPVKYLEFISEAIIHVLQN MYG_GALCR 97 0 -
HKIPVKYLEFISDAIIQVLQN MYG_LYCPI 97 0 -
HKISVQFLEFISEAIIQVIQS MYG_DIDMA 97 0 -
HKIPIKYLEFISEAIIHVLHS MYG_PHOSI 97 0 -
HKIPVKYLEFISDAIIHVLHA MYG_SHEEP 97 0 -
HKIPVKYLEFISDAIIHVLHA MYG_CEREL 97 0 -
HKIPVKYLEFISDAIIHVLHA MYG_BOVIN 97 0 -
HKIPVQFLEFISDAIIQVIQS MYG_MACRU 97 0 -
HKIPIKYLEFISDAIIHVLQS MYG_LOXAF 97 0 -
HKIPVKYLEFISEIIIEVLKK MYG_MOUSE 97 0 -
HKISIKFLEYISEAIIHVLQS MYG_ORNAN 97 0 -
HKISIKFLEFISEAIIHVLQS MYG_TACAC 97 0 -
HKIPIKYLEFISDAIIHVLQS MYG_ELEMA 97 0 -
HKIPVKYLEFISEVIIKVIAE MYG_CHICK 97 0 -
HKIPVKYLEFICEIIVKVIAE MYG_CARCR 97 0 -
HKIPVKYLEFICEIIVKVIAE MYG_GRAGE 97 0 -
HKIPVKYLEFICEIIVKVIAE MYG_CHEMY 97 0 -
HKVPVKYLEFISEAIMKVIAQ MYG_APTFO 96 0 -
HKIPIKYLEFICEVIVGVIAE MYG_VARVA 97 0 -
HKIPVKYLEFISEIIVKVIAE MYG_ALLMI 98 0 -
HKIPINNFKLISEVLVKVMHE MYG_THUAL 92 0 -
HKIPPKNFVLITNIAVKVLTE MYG_HETPO 92 0 -
HKIALNNFRLITEVLVKVMAE MYG_CYPCA 92 0 -
HKIPPHYFTKITTIAVDVLSE MYG_MUSAN 92 0 -
HKIPPHYFTKITTIAVGVLSE MYG_GALJA 92 0 -
HKIPPHYFTKITTIAVGVLSE MYG_GALAU 92 0 -
HKIPIINFKLIAEVIGKVMEE P87497 93 0 -

Motif 6 width=30
Element Seqn Id St Int Rpt
FGADAQGAMSKALELFRNDMAAKYKELGFQ MYG_PIG 123 5 -
FGADAQGAMKRALELFRNDIAAKYKELGFQ MYG_LUTLU 123 5 -
FGADAQAAMSKALELFRNDIAAKYKELGFQ MYG_TUPGL 123 5 -
FGADAQAAMNKALELFRKDIAAKYKELGFH MYG_INIGE 123 5 -
FGADAQAAMKKALELFRNDIAAKYKELGFQ MYG_LEPMU 123 5 -
FGADAQGAMNKALELFRNDMAAKYKELGFQ MYG_MACFA 123 5 -
FGADAQGAMNKALELFRNDMAAKYKELGFQ MYG_PAPAN 123 5 -
FGADAQGAMNKALELFRKDIAAKYKELGFH MYG_GLOME 123 5 -
FGADAQGAMGKALELFRNDIAAKYKELGFQ MYG_ROUAE 123 5 -
FGADAQGAMNKALELFRKDMASNYKELGFQ MYG_GORBE 123 5 -
FGADAQGAMNKALELFRKDMASNYKELGFQ MYG_HUMAN 123 5 -
FGADAQGAMNKALELFRKDMASNYKELGFQ MYG_HYLAG 123 5 -
FGADAQGAMNKALELFRKDMASNYKELGFQ MYG_PONPY 123 5 -
FGADAQGAMNKALELFRKDIATKYKELGFH MYG_PHOPH 123 5 -
FGADAQGAMNKALELFRKDIAAKYKELGFH MYG_TURTR 123 5 -
FGADAQGAMNKALELFRKDMASNYKELGFQ MYG_PANTR 123 5 -
FGADAQAAMSKALELFRNDIAAQYKELGFQ MYG_RABIT 123 5 -
FGADAQGAMTKALELFRNDIAAKYKELGFQ MYG_HORSE 123 5 -
FGADAQGAMKKALELFRNDMAAKYKELGFQ MYG_AOTTR 123 5 -
FGADAQGAMKKALELFRNDMAAKYKELGFQ MYG_CALJA 123 5 -
FGADAQAAMNKALELFRKDIAAKYKELGFQ MYG_ESCGI 123 5 -
FGADAQAAMNKALELFRKDIAAKYKELGFQ MYG_MEGNO 123 5 -
FGADAQGAMNKALELFRKDIAAKYKELGFH MYG_ORCOR 123 5 -
FGADAQGAMSKALELFRNDMAAKYKELGFQ MYG_OCHPR 123 5 -
FGADAQGAMNKALELFRNDIAAKYKELGFQ MYG_PERPO 123 5 -
FAAEAQGAMKKALELFRNDIAAKYKELGFQ MYG_MELME 123 5 -
FGADAQAAMSKALELFRNDIAAKYKELGFQ MYG_LAGMA 123 5 -
FGADAQGAMKKALELFRNDMAAKYKELGFQ MYG_CEBAP 123 5 -
FGADTHAAMKKALELFRNDIAAKYRELGFQ MYG_ZALCA 123 5 -
FGADAQGAMTKALELFRKDIAAKYKELGFH MYG_MESCA 123 5 -
FGADAQGAMSKALELFRNDIAAKYKELGFQ MYG_ORYAF 123 5 -
FGADABGAMNKALELFRKDIAAKYKELGFQ MYG_CASFI 123 5 -
FGADAQAAMTKALELFRKDIAAKYKELGFH MYG_ZIPCA 123 5 -
FGADAQAAMKKALELFRNDIAAKYKELGFH MYG_HALGR 123 5 -
FGADAQGAMSKALELFRNDIAAKYKELGFQ MYG_PROGU 123 5 -
FGADAQAAMNKALELFRKDIAAKYKELGFQ MYG_BALAC 123 5 -
FGADAQGAMSKALELFRNDIAAKYKELGFQ MYG_CTEGU 123 5 -
FGADAQGAMSKALELFRNDIAAKYKELGFQ MYG_ERIEU 123 5 -
FGADAQGAMSKALELFRNDIAAKYKELGFQ MYG_NYCCO 123 5 -
FGADAQGAMKKALELFRNDMAAKYKELGFQ MYG_LAGLA 123 5 -
FGADVZGAMKRALELFRNDIAAKYKELGFQ MYG_ONDZI 123 5 -
FHADTEAAMKKALELFRNDIAAKYKELGFQ MYG_VULCH 123 5 -
FGADAQAAMNKALELFRKDIAAKYKELGFQ MYG_BALPH 123 5 -
FGADAQGAMSKALELFRNDIAAKYKELGFQ MYG_SPAEH 123 5 -
FGADAQGAMKKALELFRNDMAAKYKELGFQ MYG_SAISC 123 5 -
FGADAQGAMNKALELFRKDIAAKYKELGYQ MYG_PHYCA 123 5 -
FGADAQGAMSKALELFRKDIAAKYKELGYQ MYG_KOGSI 123 5 -
FHADTEAAMKKALELFRNDIAAKYKELGFQ MYG_CANFA 123 5 -
FGTDVQGAMSKALELFRNDIAAKYKELGFQ MYG_GALCR 123 5 -
FHADTEAAMKKALELFRNDIAAKYKELGFQ MYG_LYCPI 123 5 -
FGGDAQAAMGKALELFRNDMAAKYKELGFQ MYG_DIDMA 123 5 -
FGADAQAAMKKALELFRNDIAAKIKELGFH MYG_PHOSI 123 5 -
FGADAQGAMSKALELFRNDMAAEYKVLGFQ MYG_SHEEP 123 5 -
FGADAQGAMSKALELFRNDMAAQYKVLGFQ MYG_CEREL 123 5 -
FGADAQAAMSKALELFRNDMAAQYKVLGFH MYG_BOVIN 123 5 -
FGADAQAAMKKALELFRHDMAAKYKEFGFQ MYG_MACRU 123 5 -
FGADAQAAMKKALELFRNDIAAKYKELGFQ MYG_LOXAF 123 5 -
FGADAQGAMSKALELFRNDIAAKYKELGFQ MYG_MOUSE 123 5 -
FGADAQAAMGKALELFRNDMAAKYKEFGFQ MYG_ORNAN 123 5 -
FGADAQAAMGKALELFRNDMATKYKEFGFQ MYG_TACAC 123 5 -
FGADAQGAMKKALELFRNDIAAKYKELGFQ MYG_ELEMA 123 5 -
FGADSQAAMKKALELFRNDMASKYKEFGFQ MYG_CHICK 123 5 -
FGADSQAAMKKALELFRNDMASKYKEFGFQ MYG_CARCR 123 5 -
FGADSQAAMRKALELFRNDMASKYKEFGFQ MYG_GRAGE 123 5 -
FGADSQAAMKKALELFRNDMASKYKEFGFL MYG_CHEMY 123 5 -
FGADAQEAMKKALELFRNDMASKYKEFGFQ MYG_APTFO 122 5 -
FGADSQEAMRKALELFRNDMASRYKELGFQ MYG_VARVA 123 5 -
FGADSQAAMRKALELFRNDMASKYKEFGYQ MYG_ALLMI 124 5 -
LDAGGQTALRNVMGIIIADLEANYKELGFS MYG_THUAL 116 3 -
MTGPMQESFSKVFTVICSDLETLYKEANFQ MYG_HETPO 118 5 -
LDAGGQSALRRVMDVVIGDIDTYYKEIGFA MYG_CYPCA 116 3 -
MNAQVQAAFSGAFKIICSDIEKEYKAANFQ MYG_MUSAN 118 5 -
MNAQAQAAFSGAFKNICSDIEKEYKAANFQ MYG_GALJA 118 5 -
MNAQAQEAFSGAFKSICSDIEKEYKAANFQ MYG_GALAU 118 5 -
LDAAGQTALRNVMAIIITDMEADYKELGFT P87497 117 3 -