WORKLIST ENTRIES (1):

GLHYDRLASE52 View alignment     Glycosyl hydrolase family 52 signature
 Type of fingerprint: COMPOUND with 7  elements
Links:
   PRINTS; PR00131 GLHYDRLASE1; PR00132 GLHYDRLASE2; PR00133 GLHYDRLASE3
   PRINTS; PR00732 GLHYDRLASE4; PR00733 GLHYDRLASE6; PR00734 GLHYDRLASE7
   PRINTS; PR00735 GLHYDRLASE8; PR00134 GLHYDRLASE10; PR00911 GLHYDRLASE11
   PRINTS; PR00736 GLHYDRLASE15; PR00737 GLHYDRLASE16; PR00738 GLHYDRLASE20
   PRINTS; PR00739 GLHYDRLASE26; PR00740 GLHYDRLASE27; PR00741 GLHYDRLASE29
   PRINTS; PR00843 GLHYDRLASE30; PR00742 GLHYDRLASE35; PR00743 GLHYDRLASE36
   PRINTS; PR00744 GLHYDRLASE37; PR00745 GLHYDRLASE39; PR00746 GLHYDRLASE41
   PRINTS; PR00747 GLHYDRLASE47; PR00844 GLHYDRLASE48; PR00846 GLHYDRLASE56
   PRINTS; PR00849 GLHYDRLASE58; PR00850 GLHYDRLASE59; PR00748 MELIBIASE
   PRINTS; PR00137 LYSOZYME; PR00684 T4LYSOZYME; PR00749 LYSOZYMEG
   PRINTS; PR00110 ALPHAAMYLASE; PR00750 BETAAMYLASE
   INTERPRO; IPR000852

 Creation date 26-FEB-1998; UPDATE 07-JUN-1999

   1. HENRISSAT, B.
   A classification of glycosyl hydrolases based on amino acid sequence 
   similarities.
   BIOCHEM.J. 280 309-316 (1991).

   2. HENRISSAT, B. AND BAIROCH, A.
   New families in the classification of glycosyl hydrolases based on amino
   acid sequence similarities.
   BIOCHEM.J. 293 781-788 (1993).

   3. HENRISSAT, B. AND BAIROCH, A.
   Updating the sequence-based classification of glycosyl hydrolases.
   BIOCHEM.J. 316 695-696 (1996).

   4. EL HASSOUNI, M., HENRISSAT, B., CHIPPAUX, M. AND BARRAS, F.
   Nucleotide sequences of the Arb genes, which control beta-glucosidase
   utilisation in Erwinia chrysanthemi - Comparison with the Escherichia
   coli Bgl operon and evidence for a new beta-glycohydrolase family
   including enzymes from eubacteria, archaebacteria and humans.
   J.BACTERIOL. 174 765-777 (1992).
  
   5. BABA, T., SHINKE, R. AND NANMORI, T.
   Identification and characterization of clustered genes for thermostable
   xylan-degrading enzymes, beta-xylosidase and xylanase, of Bacillus 
   stearothermophilus 21.
   APPL.ENVIRON.MICROBIOL. 60 2252-2258 (1994). 

   O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that
   hydrolyse the glycosidic bond between two or more carbohydrates, or between
   a carbohydrate and a non-carbohydrate moiety. A classification system for
   glycosyl hydrolases, based on sequence similarity, has led to the definition
   of up to 60 different families [1-4] (http://expasy.hcuge.ch/cgi-bin/lists?
   glycosid.txt). Family 52 encompasses the beta-xylosidases (EC 3.2.1.37) [5].
  
   Proteins harboring beta-xylosidase and xylanase activities have been
   identified in the Gram-positive, facultative thermophilic aerobe Bacillus
   stearothermophilus 21 [5]. This microbe, which functions in xylan 
   degradation, can utilise xylan as a sole source of carbon. The enzyme
   hydrolyses 1,4-beta-D-xylans, removing successive D-xylose residues from 
   the non-reducing termini. It also hydrolyses xylobiose.
  
   GLHYDRLASE52 is a 7-element fingerprint that provides a signature for
   family 52 glycosyl hydrolases. The fingerprint was derived from an initial
   alignment of 2 sequences: the motifs were drawn from conserved regions
   spanning the N-terminal half of the alignment. Two iterations on OWL30.0 
   were required to reach convergence, at which point a true set comprising
   3 sequences was identified.
  
   An update on SPTR37_9f identified a true set of 3 sequences.

  SUMMARY INFORMATION
      3 codes involving  7 elements
      0 codes involving  6 elements
      0 codes involving  5 elements
      0 codes involving  4 elements
      0 codes involving  3 elements
      0 codes involving  2 elements

   COMPOSITE FINGERPRINT INDEX
  
    7|   3    3    3    3    3    3    3  
    6|   0    0    0    0    0    0    0  
    5|   0    0    0    0    0    0    0  
    4|   0    0    0    0    0    0    0  
    3|   0    0    0    0    0    0    0  
    2|   0    0    0    0    0    0    0  
   --+------------------------------------
     |   1    2    3    4    5    6    7  

True positives..
 XYA1_BACST     Q59230         XYA2_BACST     


  PROTEIN TITLES
   XYA1_BACST       BETA-XYLOSIDASE PRECURSOR (EC 3.2.1.37) (1,4-BETA-D-XYLAN XY
   Q59230           XYLANASE (EC 3.2.1.8) - BACILLUS STEAROTHERMOPHILUS.
   XYA2_BACST       BETA-XYLOSIDASE PRECURSOR (EC 3.2.1.37) (1,4-BETA-D-XYLAN XY

SCAN HISTORY OWL30_0 2 75 NSINGLE SPTR37_9f 2 5 NSINGLE INITIAL MOTIF SETS GLHYDRLASE521 Length of motif = 28 Motif number = 1 Glycosyl hydrolase family 52 motif I - 1 PCODE ST INT FTLGFPGKSGGLDLELARPPRQNVLIGV XYA1_BACST 20 20 FTLGYPGQSGGFDLELGSPPNQNIYIGL XYA2_BACST 29 29 GLHYDRLASE522 Length of motif = 28 Motif number = 2 Glycosyl hydrolase family 52 motif II - 1 PCODE ST INT ILIPFAKEEIQREFHVATDTWKAGDLTF XYA1_BACST 87 39 LIIPYNRDEIVRRFGAAIDEWQAGDLTF XYA2_BACST 102 45 GLHYDRLASE523 Length of motif = 21 Motif number = 3 Glycosyl hydrolase family 52 motif III - 1 PCODE ST INT LKLALVPAVIVEMTIDNTNGT XYA1_BACST 134 19 LRFALMPAVLAEITVDNTRGT XYA2_BACST 149 19 GLHYDRLASE524 Length of motif = 21 Motif number = 4 Glycosyl hydrolase family 52 motif IV - 1 PCODE ST INT SYFYTRFFQNIEEVGLYALEQ XYA1_BACST 261 106 SYYYSRYFANIEEVAEYALAQ XYA2_BACST 275 105 GLHYDRLASE525 Length of motif = 27 Motif number = 5 Glycosyl hydrolase family 52 motif V - 1 PCODE ST INT FMMAHAIRSYYGNTQLLEHEGKPIWVV XYA1_BACST 307 25 FIVAHAIRSYYGSTELLEHDGKPLWIV XYA2_BACST 321 25 GLHYDRLASE526 Length of motif = 30 Motif number = 6 Glycosyl Hydrolase Family 52 Motif VI - 1 PCODE ST INT NEGEYRMMNTFDLTVDQLFFELKLNPWTVK XYA1_BACST 334 0 NEGEYRMMNTFDLLVDQLFYELKMNPWTVK XYA2_BACST 348 0 GLHYDRLASE527 Length of motif = 21 Motif number = 7 Glycosyl Hydrolase Family 52 Motif VII - 1 PCODE ST INT CFSHMTHEQLVNWVLCAAVYI XYA1_BACST 420 56 CFSHMTHEQLVNWVLSATVYV XYA2_BACST 434 56 FINAL MOTIF SETS GLHYDRLASE521 Length of motif = 28 Motif number = 1 Glycosyl hydrolase family 52 motif I - 2 PCODE ST INT FTLGFPGKSGGLDLELARPPRQNVLIGV XYA1_BACST 20 20 FTLGFPGKSGGLDLELARPPRQNVLIGV Q59230 20 20 FTLGYPGQSGGFDLELGSPPNQNIYIGL XYA2_BACST 29 29 GLHYDRLASE522 Length of motif = 28 Motif number = 2 Glycosyl hydrolase family 52 motif II - 2 PCODE ST INT ILIPFAKEEIQREFHVATDTWKAGDLTF XYA1_BACST 87 39 ILIPFAKEEIQREFHVATDTWKAGDLTF Q59230 87 39 LIIPYNRDEIVRRFGAAIDEWQAGDLTF XYA2_BACST 102 45 GLHYDRLASE523 Length of motif = 21 Motif number = 3 Glycosyl hydrolase family 52 motif III - 2 PCODE ST INT LKLALVPAVIVEMTIDNTNGT XYA1_BACST 134 19 LKLALVPAVIVEMTIDNTNGT Q59230 134 19 LRFALMPAVLAEITVDNTRGT XYA2_BACST 149 19 GLHYDRLASE524 Length of motif = 21 Motif number = 4 Glycosyl hydrolase family 52 motif IV - 2 PCODE ST INT SYFYTRFFQNIEEVGLYALEQ XYA1_BACST 261 106 SYFYTRFFQNIEEVGLYALEQ Q59230 261 106 SYYYSRYFANIEEVAEYALAQ XYA2_BACST 275 105 GLHYDRLASE525 Length of motif = 27 Motif number = 5 Glycosyl hydrolase family 52 motif V - 2 PCODE ST INT FMMAHAIRSYYGNTQLLEHEGKPIWVV XYA1_BACST 307 25 FMMAHAIRSYYGNTQLLEHEGKPIWVV Q59230 307 25 FIVAHAIRSYYGSTELLEHDGKPLWIV XYA2_BACST 321 25 GLHYDRLASE526 Length of motif = 30 Motif number = 6 Glycosyl hydrolase family 52 motif VI - 2 PCODE ST INT NEGEYRMMNTFDLTVDQLFFELKLNPWTVK XYA1_BACST 334 0 NEGEYRMMNTFDLTVDQLFFELKLNPWTVK Q59230 334 0 NEGEYRMMNTFDLLVDQLFYELKMNPWTVK XYA2_BACST 348 0 GLHYDRLASE527 Length of motif = 21 Motif number = 7 Glycosyl hydrolase family 52 motif VII - 2 PCODE ST INT CFSHMTHEQLVNWVLCAAVYI XYA1_BACST 420 56 CFSHMTHEQLVNWVLCAAEAY Q59230 420 56 CFSHMTHEQLVNWVLSATVYV XYA2_BACST 434 56

User query: Display/Full Code "GLHYDRLASE52"